Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus® v6.5.9.3
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Tyr276  - Bcr (human)

PeptideReferences 
DNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGK 2, 3 View spectrum
FLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGK 1, 4 View spectrum

References 

1

Moritz A (2008) CST Curation Set: 3787; Year: 2008; xenograft, Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid)

2

Moritz A (2007) CST Curation Set: 3238; Year: 2007; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid)

3

Moritz A (2007) CST Curation Set: 2640; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid)

4

Moritz A (2007) CST Curation Set: 2504; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid)