Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus® v6.5.9.3
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Tyr260  - SKAP2 (mouse)

PeptideReferences 
SQPIDDEIYEELPEEEEDTASVK 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 View spectrum
SQPIDDEIYEELPEEEEDTASVKMDEQGKGSR 33, 34 View spectrum

References 

1

Gu T (2007) CST Curation Set: 3402; Year: 2007; Biosample/Treatment: cell line, Baf3(MSCV-NEO)/IL3 withdrawal; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  IL-3_withdrawal

2

Gu T (2007) CST Curation Set: 3403; Year: 2007; Biosample/Treatment: cell line, Baf3(MSCV-NEO)/IL3 withdrawal; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  IL-3_withdrawal

3

Gu T (2007) CST Curation Set: 3404; Year: 2007; Biosample/Treatment: cell line, Baf3(MSCV-NEO-FLT3/ITD)/IL3 withdrawal; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  IL-3_withdrawal

4

Gu T (2007) CST Curation Set: 3405; Year: 2007; Biosample/Treatment: cell line, Baf3(MSCV-NEO-FLT3/ITD)/IL3 withdrawal; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  IL-3_withdrawal

5

Gu T (2007) CST Curation Set: 3406; Year: 2007; Biosample/Treatment: cell line, Baf3(PLXSN-NEO-FLT3/ITD)/IL3 withdrawal; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991

6

Guo A (2007) CST Curation Set: 2988; Year: 2007; Biosample/Treatment: tissue, liver/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991

7

Guo A (2007) CST Curation Set: 2985; Year: 2007; Biosample/Treatment: tissue, liver/Insulin; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991

8

Guo A (2007) CST Curation Set: 2986; Year: 2007; Biosample/Treatment: tissue, liver/Insulin; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991

9

Guo A (2007) CST Curation Set: 2827; Year: 2007; Biosample/Treatment: tissue, heart/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991

10

Gu T (2006) CST Curation Set: 1516; Year: 2006; Biosample/Treatment: cell line, Thom/serum starved; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991

11

Gu T (2006) CST Curation Set: 1517; Year: 2006; Biosample/Treatment: cell line, Thom/serum starved; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991

12

Goss V (2006) CST Curation Set: 1403; Year: 2006; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

13

Goss V (2006) CST Curation Set: 1404; Year: 2006; Biosample/Treatment: cell line, BaF3/serum starved &'||' IL3 starvation &'||' Tpo; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  TPO, IL-3_withdrawal, serum_starvation

14

Goss V (2006) CST Curation Set: 1405; Year: 2006; Biosample1/Treatment/Isotope: cell line, BaF3/none/L, Biosample2/Treatment/Isotope: cell line, BaF3/none/H; Disease: chronic myelogenous leukemia; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

15

Goss V (2006) CST Curation Set: 1406; Year: 2006; Biosample1/Treatment/Isotope: cell line, BaF3/serum starved &'||' IL3 starvation &'||' Tpo/L, Biosample2/Treatment/Isotope: cell line, BaF3/serum starved &'||' IL3 starvation &'||' Tpo/H; Disease: chronic myelogenous leukemia; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  TPO, IL-3_withdrawal, serum_starvation

16

Goss V (2006) CST Curation Set: 1302; Year: 2006; Biosample/Treatment: cell line, BaF3/serum starved &'||' IL3 starvation; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  IL-3_withdrawal, serum_starvation

17

Goss V (2006) CST Curation Set: 1200; Year: 2006; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

18

Goss V (2005) CST Curation Set: 860; Year: 2005; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

19

Goss V (2005) CST Curation Set: 862; Year: 2005; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

20

Goss V (2005) CST Curation Set: 847; Year: 2005; Biosample/Treatment: cell line, BaF3/serum starved; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  serum_starvation

21

Goss V (2005) CST Curation Set: 848; Year: 2005; Biosample/Treatment: cell line, BaF3/serum starved; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  serum_starvation

22

Goss V (2005) CST Curation Set: 814; Year: 2005; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

23

Goss V (2005) CST Curation Set: 813; Year: 2005; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

24

Goss V (2005) CST Curation Set: 815; Year: 2005; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

25

Goss V (2005) CST Curation Set: 816; Year: 2005; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

26

Gu T (2005) CST Curation Set: 699; Year: 2005; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

27

Gu T (2005) CST Curation Set: 700; Year: 2005; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

28

Goss V (2005) CST Curation Set: 670; Year: 2005; Biosample/Treatment: cell line, BaF3/serum starved &'||' Tpo; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  TPO, serum_starvation

29

Guo A (2005) CST Curation Set: 632; Year: 2005; Biosample/Treatment: cell line, 3T3/EGF; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 3T3 (fibroblast)
Treatments:  EGF

30

Goss V (2004) CST Curation Set: 494; Year: 2004; Biosample/Treatment: cell line, BaF3/serum starved &'||' Tpo; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  TPO, serum_starvation

31

Goss V (2004) CST Curation Set: 495; Year: 2004; Biosample/Treatment: cell line, BaF3/serum starved &'||' Tpo; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  TPO, serum_starvation

32

Goss V (2004) CST Curation Set: 496; Year: 2004; Biosample/Treatment: cell line, BaF3/serum starved; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  serum_starvation

33

Goss V (2004) CST Curation Set: 385; Year: 2004; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

34

Goss V (2004) CST Curation Set: 386; Year: 2004; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')

35

Goss V (2004) CST Curation Set: 396; Year: 2004; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')
Treatments:  TPO

36

Li Y (2004) CST Curation Set: 380; Year: 2004; Biosample/Treatment: cell line, 831/13/Serum starved; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 831/13
Treatments:  serum_starvation

37

Moritz A (2004) CST Curation Set: 266; Year: 2004; Biosample/Treatment: cell line, 3T3/serum starved; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 3T3 (fibroblast)
Treatments:  serum_starvation

38

Moritz A (2003) CST Curation Set: 151; Year: 2003; Biosample/Treatment: cell line, 3T3/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 3T3 (fibroblast)

39

Goss V (2003) CST Curation Set: 34; Year: 2003; Biosample/Treatment: cell line, BaF3/pervanadate &'||' Flt3 ligand; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor')