Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus® v6.5.9.3
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Ser344  - MYH9 (human)

PeptideReferences 
TMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKE 1 View spectrum

References 

1

Possemato A (2007) CST Curation Set: 2681; Year: 2007; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXT-P) (81E12B5) Rabbit mAb Cat#: 10003
Cell Line/Tissue: K562 (erythroid)