Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus® v6.5.9.3
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Tyr4034  - RNF213 (human)

PeptideReferences 
AWFASEQMICPYCLTALPDEFSPAVSQAHR 1, 2, 3 View spectrum

References 

1

Gu T (2006) CST Curation Set: 1936; Year: 2006; Biosample/Treatment: cell line, L540/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: L540 (lymphoid)

2

Guo A (2006) CST Curation Set: 1628; Year: 2006; Biosample/Treatment: cell line, SNU-1/untreated; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SNU-1 (gastric)

3

Gu T (2006) CST Curation Set: 1627; Year: 2006; Biosample/Treatment: cell line, L540/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: L540 (lymphoid)