Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus® v6.5.9.3
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Tyr477  - CENTD1 (human)

PeptideReferences 
HSYPLSSTSGNADSSAVSSQAISPYACFYGASAK 1 View spectrum

References 

1

Goss V (2004) CST Curation Set: 349; Year: 2004; Biosample/Treatment: cell line, SUP-B15/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SUP-B15 (B lymphocyte)