Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage Cell Signaling Technology
PhosphoSitePlus
Home | Login
About PhosphoSiteUsing PhosphoSiteprivacy & cookiesCuration ProcessContact
logos LINCs Logo Mt Sinai Logo NIH Logo NCI Logo
Search / Browse Functions
Spectra Page for site:
Tyr1343 - ITGB4 (human)

Peptide References  
RPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLR 1 View spectrum

References

1

Guo A (2006) CST Curation Set: 1645; Year: 2006; Biosample/Treatment: cell line, KATO III/untreated; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KATO III (gastric)

Home  |  Login With enhanced literature mining using Linguamatics I2E I2E Logo Produced by 3rd Millennium  |  Design by Digizyme
©2003-2017 Cell Signaling Technology, Inc.