Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus®
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Tyr1343  - ITGB4 (human)

PeptideReferences 
RPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLR 1 View spectrum

References 

1

Guo A (2006) CST Curation Set: 1645; Year: 2006; Biosample/Treatment: cell line, KATO III/untreated; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KATO III (gastric)