|
Powered by Cell Signaling Technology |
Peptide | References | |
---|---|---|
GVAAPPPKNSFNNPAYYVLE | 36 | View spectrum |
NSFNNPAYYVLEGVPHQLLPPEPPSPAR | 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 391, 392, 393, 394, 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448 | View spectrum |
NSFNNPAYYVLEGVPHQLLPPEPPSPARAPVPSATK | 26, 29, 80, 84, 86, 162, 163, 210, 240, 241, 265, 266, 267, 270, 273, 274, 292, 302, 303, 315, 320, 321, 322, 323, 330, 345, 353, 362, 363, 376, 377, 379, 385, 398, 409, 412, 419, 430, 431, 434, 436 | View spectrum |
References | |
---|---|
Stokes M (2007) CST Curation Set: 3553; Year: 2007; Biosample/Treatment: cell line, 143B/serum starved; Disease: osteosarcoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 143B (bone cell) Treatments: serum_starvation |
|
Moritz A (2007) CST Curation Set: 3486; Year: 2007; Biosample/Treatment: cell line, K562/Gleevec &'||' untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 3487; Year: 2007; Biosample/Treatment: cell line, K562/Gleevec &'||' untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Ren H (2007) CST Curation Set: 3473; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Ren H (2007) CST Curation Set: 3439; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: ovary |
|
Ren H (2007) CST Curation Set: 3385; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Ren H (2007) CST Curation Set: 3386; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Ren H (2007) CST Curation Set: 3388; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Ren H (2007) CST Curation Set: 3389; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Ren H (2007) CST Curation Set: 3390; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Ren H (2007) CST Curation Set: 3401; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2007) CST Curation Set: 3308; Year: 2007; Biosample/Treatment: tissue, blood/untreated; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2007) CST Curation Set: 3309; Year: 2007; Biosample/Treatment: tissue, blood/untreated; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2007) CST Curation Set: 3276; Year: 2007; Biosample/Treatment: cell line, L-1236/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2007) CST Curation Set: 3278; Year: 2007; Biosample/Treatment: cell line, KM-H2/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2007) CST Curation Set: 3279; Year: 2007; Biosample/Treatment: cell line, KM-H2/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 3250; Year: 2007; Biosample/Treatment: cell line, K562/Gleevec &'||' Gleevec; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) Treatments: imatinib |
|
Moritz A (2007) CST Curation Set: 3251; Year: 2007; Biosample/Treatment: cell line, K562/Gleevec &'||' Gleevec; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) Treatments: imatinib |
|
Moritz A (2007) CST Curation Set: 3246; Year: 2007; Biosample/Treatment: cell line, K562/untreated &'||' untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 3247; Year: 2007; Biosample/Treatment: cell line, K562/untreated &'||' untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 3248; Year: 2007; Biosample/Treatment: cell line, K562/untreated &'||' untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 3249; Year: 2007; Biosample/Treatment: cell line, K562/Gleevec &'||' Gleevec; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) Treatments: imatinib |
|
Stokes M (2007) CST Curation Set: 3243; Year: 2007; Biosample/Treatment: cell line, SK-ES-1/serum starved; Disease: Ewing's sarcoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SK-ES-1 Treatments: serum_starvation |
|
Stokes M (2007) CST Curation Set: 3239; Year: 2007; Biosample/Treatment: cell line, 143.98.2/serum starved; Disease: osteosarcoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 143.98.2 (bone cell) Treatments: serum_starvation |
|
Moritz A (2007) CST Curation Set: 3237; Year: 2007; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 3238; Year: 2007; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Stokes M (2007) CST Curation Set: 3198; Year: 2007; Biosample/Treatment: cell line, K562/serum starved; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) Treatments: serum_starvation |
|
Gu T (2007) CST Curation Set: 3071; Year: 2007; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2007) CST Curation Set: 3076; Year: 2007; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Michaud C (2007) CST Curation Set: 2882; Year: 2007; Biosample/Treatment: cell line, HCC202/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC202 (breast cell) Treatments: serum_starvation |
|
Michaud C (2007) CST Curation Set: 2886; Year: 2007; Biosample/Treatment: cell line, MDA-MB436/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-436 (breast cell) Treatments: serum_starvation |
|
Rikova K (2007) CST Curation Set: 2869; Year: 2007; Biosample/Treatment: cell line, NCI-H1703/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1703 (squamous) Treatments: serum_starvation |
|
Rikova K (2007) CST Curation Set: 2870; Year: 2007; Biosample/Treatment: cell line, A549/serum starved; Disease: lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: A549 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2007) CST Curation Set: 2871; Year: 2007; Biosample/Treatment: cell line, A549/serum starved; Disease: lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: A549 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2007) CST Curation Set: 2875; Year: 2007; Biosample/Treatment: cell line, HCC827/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC827 (pulmonary) Treatments: serum_starvation |
|
Guo A (2007) CST Curation Set: 2781; Year: 2007; Biosample/Treatment: cell line, MKN-45/-; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Michaud C (2007) CST Curation Set: 2688; Year: 2007; Biosample/Treatment: cell line, HCC1187/serum starved; Disease: breast ductal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Michaud C (2007) CST Curation Set: 2689; Year: 2007; Biosample/Treatment: cell line, HCC1187/serum starved; Disease: breast ductal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Michaud C (2007) CST Curation Set: 2692; Year: 2007; Biosample/Treatment: cell line, UACC-893/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Michaud C (2007) CST Curation Set: 2693; Year: 2007; Biosample/Treatment: cell line, UACC-893/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2640; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2641; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2642; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2634; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2635; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2636; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2615; Year: 2007; Biosample/Treatment: cell line, K-562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2616; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2617; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2576; Year: 2007; Biosample/Treatment: cell line, K-562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2577; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2578; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2580; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2581; Year: 2007; Biosample/Treatment: cell line, K-562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2585; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Guo A (2007) CST Curation Set: 2566; Year: 2007; Biosample/Treatment: cell line, NCI-H358/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2548; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2549; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2550; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2551; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Cherry J (2007) CST Curation Set: 2528; Year: 2007; Biosample/Treatment: cell line, MV4-11/SAHA 3h; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) Treatments: vorinostat |
|
Cherry J (2007) CST Curation Set: 2529; Year: 2007; Biosample/Treatment: cell line, MV4-11/SAHA 3h; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) Treatments: vorinostat |
|
Cherry J (2007) CST Curation Set: 2530; Year: 2007; Biosample/Treatment: cell line, MV4-11/DMSO; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) Treatments: DMSO |
|
Cherry J (2007) CST Curation Set: 2531; Year: 2007; Biosample/Treatment: cell line, MV4-11/DMSO; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) Treatments: DMSO |
|
Cherry J (2007) CST Curation Set: 2532; Year: 2007; Biosample/Treatment: cell line, MV4-11/SAHA 6h; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) Treatments: vorinostat |
|
Cherry J (2007) CST Curation Set: 2533; Year: 2007; Biosample/Treatment: cell line, MV4-11/SAHA 6h; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) Treatments: vorinostat |
|
Moritz A (2007) CST Curation Set: 2507; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2503; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2504; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2505; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2506; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Li Y (2007) CST Curation Set: 2488; Year: 2007; Biosample/Treatment: cell line, NCI-H3255/untreated; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H3255 (pulmonary) |
|
Li Y (2007) CST Curation Set: 2490; Year: 2007; Biosample/Treatment: cell line, HCC827/untreated; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC827 (pulmonary) |
|
Li Y (2007) CST Curation Set: 2494; Year: 2007; Biosample/Treatment: cell line, MKN-45/untreated &'||' TSA; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MKN-45 (gastric) Treatments: trichostatin_A |
|
Moritz A (2007) CST Curation Set: 2443; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2444; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2445; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2446; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2447; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Li Y (2007) CST Curation Set: 2426; Year: 2007; Biosample/Treatment: cell line, MKN-45/untreated; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MKN-45 (gastric) |
|
Li Y (2007) CST Curation Set: 2427; Year: 2007; Biosample/Treatment: cell line, MKN-45/untreated &'||' TSA; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MKN-45 (gastric) Treatments: trichostatin_A |
|
Moritz A (2007) CST Curation Set: 2404; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2405; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2406; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2407; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2408; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2409; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2410; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 2411; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Rikova K (2007) CST Curation Set: 2353; Year: 2007; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Rikova K (2007) CST Curation Set: 2348; Year: 2007; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Michaud C (2007) CST Curation Set: 2300; Year: 2007; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Cherry J (2007) CST Curation Set: 2253; Year: 2007; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Cherry J (2007) CST Curation Set: 2216; Year: 2007; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Cherry J (2006) CST Curation Set: 2165; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Cherry J (2006) CST Curation Set: 2168; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Rikova K (2006) CST Curation Set: 2162; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Michaud C (2006) CST Curation Set: 2137; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Rikova K (2006) CST Curation Set: 2128; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Rikova K (2006) CST Curation Set: 2133; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Michaud C (2006) CST Curation Set: 2107; Year: 2006; Biosample/Treatment: cell line, HCC1599/0.5% serum; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC1599 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 2108; Year: 2006; Biosample/Treatment: cell line, HCC1599/0.5% serum; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC1599 (breast cell) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 2101; Year: 2006; Biosample/Treatment: cell line, 639L/serum starved; Disease: kidney cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 639V (renal) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 2102; Year: 2006; Biosample/Treatment: cell line, BC-3C/serum starved; Disease: bladder cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BC-3C (bladder cell) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 2103; Year: 2006; Biosample/Treatment: cell line, SW780/serum starved; Disease: bladder cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW780 (bladder cell) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 2104; Year: 2006; Biosample/Treatment: cell line, A-704/serum starved; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Rikova K (2006) CST Curation Set: 2105; Year: 2006; Biosample/Treatment: cell line, SW1710/serum starved; Disease: bladder cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW1710 (bladder cell) Treatments: serum_starvation |
|
Yu J (2006) CST Curation Set: 2086; Year: 2006; Biosample/Treatment: tissue, larynx/-; Disease: laryngeal cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2006) CST Curation Set: 2060; Year: 2006; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2006) CST Curation Set: 2061; Year: 2006; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2006) CST Curation Set: 2062; Year: 2006; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2006) CST Curation Set: 2063; Year: 2006; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2006) CST Curation Set: 2066; Year: 2006; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2006) CST Curation Set: 2067; Year: 2006; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Possemato A (2006) CST Curation Set: 2022; Year: 2006; Biosample/Treatment: cell line, K562/serum starved; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) Treatments: serum_starvation |
|
Possemato A (2006) CST Curation Set: 2023; Year: 2006; Biosample/Treatment: cell line, K562/serum starved; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) Treatments: serum_starvation |
|
Possemato A (2006) CST Curation Set: 2024; Year: 2006; Biosample/Treatment: cell line, K562/serum starved; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) Treatments: serum_starvation |
|
Moritz A (2006) CST Curation Set: 2020; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 2021; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Michaud C (2006) CST Curation Set: 1986; Year: 2006; Biosample/Treatment: cell line, AU565/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: AU565 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1987; Year: 2006; Biosample/Treatment: cell line, AU565/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: AU565 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1988; Year: 2006; Biosample/Treatment: cell line, CAL-51/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CAL-51 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1989; Year: 2006; Biosample/Treatment: cell line, CAL-51/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CAL-51 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1990; Year: 2006; Biosample/Treatment: cell line, HCC38/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC38 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1991; Year: 2006; Biosample/Treatment: cell line, HCC38/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC38 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1992; Year: 2006; Biosample/Treatment: cell line, HCC70/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC70 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1993; Year: 2006; Biosample/Treatment: cell line, HCC70/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC70 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1994; Year: 2006; Biosample/Treatment: cell line, MT-3/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MT-3 (breast cell) Treatments: serum_starvation |
|
Gu T (2006) CST Curation Set: 1933; Year: 2006; Biosample/Treatment: cell line, L428/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: L428 (lymphoid) |
|
Gu T (2006) CST Curation Set: 1934; Year: 2006; Biosample/Treatment: cell line, HD-MyZ/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HD-MyZ (myeloid) |
|
Gu T (2006) CST Curation Set: 1935; Year: 2006; Biosample/Treatment: cell line, HDLM-2/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HDLM-2 (lymphoid) |
|
Gu T (2006) CST Curation Set: 1936; Year: 2006; Biosample/Treatment: cell line, L540/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: L540 (lymphoid) |
|
Guo A (2006) CST Curation Set: 1926; Year: 2006; Biosample/Treatment: tissue, breast/-; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: breast |
|
Guo A (2006) CST Curation Set: 1929; Year: 2006; Biosample/Treatment: cell line, SNU-5/-; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SNU-5 (gastric) |
|
Moritz A (2006) CST Curation Set: 1920; Year: 2006; Biosample/Treatment: cell line, Molm 14/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Molm 14 (myeloid) |
|
Guo A (2006) CST Curation Set: 1921; Year: 2006; Biosample/Treatment: cell line, NCI-H1781/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1781 (pulmonary) Treatments: serum_starvation |
|
Yu J (2006) CST Curation Set: 1913; Year: 2006; Biosample/Treatment: cell line, Kyse140/serum starved; Disease: esophageal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Kyse140 (esophageal) Treatments: serum_starvation |
|
Moritz A (2006) CST Curation Set: 1895; Year: 2006; Biosample/Treatment: cell line, MV4-11/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) |
|
Stokes M (2006) CST Curation Set: 1888; Year: 2006; Biosample/Treatment: cell line, SiMa/serum starved; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SiMa (neural crest) Treatments: serum_starvation |
|
Stokes M (2006) CST Curation Set: 1889; Year: 2006; Biosample/Treatment: cell line, 142-NF-5509/serum starved; Disease: glioblastoma multiforme; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Stokes M (2006) CST Curation Set: 1890; Year: 2006; Biosample/Treatment: cell line, 66-NP-9977/serum starved; Disease: glioblastoma multiforme; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2006) CST Curation Set: 1874; Year: 2006; Biosample/Treatment: cell line, MUTZ-5/untreated; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MUTZ-5 (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1875; Year: 2006; Biosample/Treatment: cell line, CMS/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CMS (myeloid) |
|
Gu T (2006) CST Curation Set: 1877; Year: 2006; Biosample/Treatment: cell line, EOL-1/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: EOL-1 (myeloid) |
|
Gu T (2006) CST Curation Set: 1878; Year: 2006; Biosample/Treatment: cell line, EOL-1/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: EOL-1 (myeloid) |
|
Rikova K (2006) CST Curation Set: 1863; Year: 2006; Biosample/Treatment: cell line, Caki-2/serum starved; Disease: kidney cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Caki-2 (renal) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1864; Year: 2006; Biosample/Treatment: cell line, 5637/serum starved; Disease: bladder cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 5637 (bladder cell) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1857; Year: 2006; Biosample1/Treatment/Isotope: cell line, NCI-H3255/TSA 24h/L, Biosample2/Treatment/Isotope: cell line, NCI-H3255/none/H; Disease: non-small cell lung cancer; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H3255 (pulmonary) Treatments: trichostatin_A |
|
Guo A (2006) CST Curation Set: 1859; Year: 2006; Biosample1/Treatment/Isotope: cell line, HCC78/TSA 24h/L, Biosample2/Treatment/Isotope: cell line, HCC78/none/H; Disease: non-small cell lung cancer; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC78 (pulmonary) Treatments: trichostatin_A |
|
Gu T (2006) CST Curation Set: 1850; Year: 2006; Biosample/Treatment: bone marrow, myeloid/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: myeloid-bone marrow |
|
Gu T (2006) CST Curation Set: 1851; Year: 2006; Biosample/Treatment: bone marrow, myeloid/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: myeloid-bone marrow |
|
Moritz A (2006) CST Curation Set: 1832; Year: 2006; Biosample/Treatment: cell line, SEM/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SEM (B lymphocyte) |
|
Moritz A (2006) CST Curation Set: 1822; Year: 2006; Biosample/Treatment: cell line, SEM/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SEM (B lymphocyte) |
|
Moritz A (2006) CST Curation Set: 1966; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1967; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Michaud C (2006) CST Curation Set: 1813; Year: 2006; Biosample/Treatment: cell line, EFM-19/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: EFM-19 (breast cell) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1816; Year: 2006; Biosample/Treatment: cell line, J82/serum starved; Disease: bladder cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: J82 (bladder cell) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1817; Year: 2006; Biosample/Treatment: cell line, A498/serum starved; Disease: kidney cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: A498 (renal) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1818; Year: 2006; Biosample/Treatment: cell line, Caki-2/serum starved; Disease: kidney cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Caki-2 (renal) Treatments: serum_starvation |
|
Yu J (2006) CST Curation Set: 1798; Year: 2006; Biosample/Treatment: cell line, Kyse270/serum starved; Disease: esophageal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Kyse270 (esophageal) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1792; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Gu T (2006) CST Curation Set: 1790; Year: 2006; Biosample/Treatment: cell line, SUP-T13/untreated; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SUP-T13 (T lymphocyte) |
|
Gu T (2006) CST Curation Set: 1791; Year: 2006; Biosample/Treatment: cell line, CHRF/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CHRF (megakaryocyte) |
|
Moritz A (2006) CST Curation Set: 1781; Year: 2006; Biosample/Treatment: cell line, HEL/Flt3 inhibitor; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Moritz A (2006) CST Curation Set: 1783; Year: 2006; Biosample/Treatment: cell line, HEL/-; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Moritz A (2006) CST Curation Set: 1750; Year: 2006; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1751; Year: 2006; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1752; Year: 2006; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1753; Year: 2006; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Rikova K (2006) CST Curation Set: 1741; Year: 2006; Biosample/Treatment: cell line, UM-UC-1/serum starved; Disease: bladder cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: UM-UC-1 (bladder cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1742; Year: 2006; Biosample/Treatment: cell line, CAL-148/serum starved; Disease: breast ductal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CAL-148 (breast cell) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1736; Year: 2006; Biosample/Treatment: cell line, HDQ-P1/serum starved; Disease: breast ductal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HDQ-P1 (breast cell) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1737; Year: 2006; Biosample/Treatment: cell line, NCI-H28/serum starved; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H28 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1738; Year: 2006; Biosample/Treatment: cell line, NCI-H1355/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1355 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1739; Year: 2006; Biosample/Treatment: cell line, Cal-12T/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Gu T (2006) CST Curation Set: 1725; Year: 2006; Biosample/Treatment: cell line, OPM-1/untreated; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: OPM-1 (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1726; Year: 2006; Biosample/Treatment: cell line, OPM-1/untreated; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: OPM-1 (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1728; Year: 2006; Biosample/Treatment: cell line, KMS-11/untreated; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KMS-11 (B lymphocyte) |
|
Rikova K (2006) CST Curation Set: 1700; Year: 2006; Biosample/Treatment: cell line, NCI-H2452/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2452 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1703; Year: 2006; Biosample/Treatment: cell line, LCLC-103H/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: LCLC-103H (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1704; Year: 2006; Biosample/Treatment: cell line, LXF-289/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: LXF-289 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1705; Year: 2006; Biosample/Treatment: cell line, Colo-699/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: COLO-699 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1694; Year: 2006; Biosample/Treatment: cell line, NCI-H2052/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2052 (pulmonary) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1695; Year: 2006; Biosample/Treatment: cell line, CAL-85-1/serum starved; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CAL-85-1 (breast cell) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1696; Year: 2006; Biosample/Treatment: cell line, NCI-H2342/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2342 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1697; Year: 2006; Biosample/Treatment: cell line, NCI-H1838/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1838 (pulmonary) Treatments: serum_starvation |
|
Michaud C (2006) CST Curation Set: 1698; Year: 2006; Biosample/Treatment: cell line, KPL-1/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KPL-1 (breast cell) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1699; Year: 2006; Biosample/Treatment: cell line, NCI-H2073/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2073 (pulmonary) Treatments: serum_starvation |
|
Moritz A (2006) CST Curation Set: 1687; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1688; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1689; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1691; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Gu T (2006) CST Curation Set: 1673; Year: 2006; Biosample/Treatment: bone marrow, myeloid/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: myeloid-bone marrow |
|
Li Y (2006) CST Curation Set: 1656; Year: 2006; Biosample/Treatment: cell line, SNU-C2B/untreated; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SNU-C2B (intestinal) |
|
Li Y (2006) CST Curation Set: 1657; Year: 2006; Biosample/Treatment: cell line, SNU-C2B/untreated &'||' TSA; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SNU-C2B (intestinal) Treatments: trichostatin_A |
|
Guo A (2006) CST Curation Set: 1645; Year: 2006; Biosample/Treatment: cell line, KATO III/untreated; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KATO III (gastric) |
|
Li Y (2006) CST Curation Set: 1639; Year: 2006; Biosample/Treatment: cell line, HT-29/untreated &'||' TSA; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HT-29 (intestinal) Treatments: trichostatin_A |
|
Gu T (2006) CST Curation Set: 1625; Year: 2006; Biosample/Treatment: cell line, HD-MyZ/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HD-MyZ (myeloid) |
|
Gu T (2006) CST Curation Set: 1626; Year: 2006; Biosample/Treatment: cell line, L428/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: L428 (lymphoid) |
|
Gu T (2006) CST Curation Set: 1627; Year: 2006; Biosample/Treatment: cell line, L540/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: L540 (lymphoid) |
|
Guo A (2006) CST Curation Set: 1605; Year: 2006; Biosample/Treatment: cell line, MKN-45/untreated; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MKN-45 (gastric) |
|
Gu T (2006) CST Curation Set: 1596; Year: 2006; Biosample/Treatment: cell line, MHH-CALL4/untreated; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MHH-CALL4 (B lymphocyte) |
|
Li Y (2006) CST Curation Set: 1589; Year: 2006; Biosample/Treatment: cell line, SW48/untreated; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW48 (intestinal) |
|
Gu T (2006) CST Curation Set: 1575; Year: 2006; Biosample/Treatment: bone marrow, myeloid/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: myeloid-bone marrow |
|
Guo A (2006) CST Curation Set: 1558; Year: 2006; Biosample/Treatment: cell line, HCC15/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC15 (pulmonary) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1559; Year: 2006; Biosample/Treatment: cell line, ES2/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: ES2 (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1560; Year: 2006; Biosample/Treatment: cell line, SKOV-3/serum starved; Disease: ovarian epithelial carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SKOV-3 (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1561; Year: 2006; Biosample/Treatment: cell line, OV90/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: OV90 (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1562; Year: 2006; Biosample/Treatment: cell line, TOV112D/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: TOV112D (ovarian) Treatments: serum_starvation |
|
Gu T (2006) CST Curation Set: 1557; Year: 2006; Biosample/Treatment: cell line, MKPL-1/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MKPL-1 (megakaryoblast) |
|
Guo A (2006) CST Curation Set: 1544; Year: 2006; Biosample/Treatment: cell line, EFO-21/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: EFO-21 (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1547; Year: 2006; Biosample/Treatment: cell line, PA-1/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: PA-1 (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1549; Year: 2006; Biosample/Treatment: cell line, HCC15/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC15 (pulmonary) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1550; Year: 2006; Biosample/Treatment: cell line, Caov-3/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Caov-3 (ovarian) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1551; Year: 2006; Biosample/Treatment: cell line, NCI-H1651/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1651 (pulmonary) Treatments: serum_starvation |
|
Moritz A (2006) CST Curation Set: 1536; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1537; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1538; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1539; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1540; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1541; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1542; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1543; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Guo A (2006) CST Curation Set: 1530; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Guo A (2006) CST Curation Set: 1535; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Moritz A (2006) CST Curation Set: 1522; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1523; Year: 2006; Biosample/Treatment: cell line, NCI-H596/serum starved; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H596 (pulmonary) Treatments: serum_starvation |
|
Moritz A (2006) CST Curation Set: 1524; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1525; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1526; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1527; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1528; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Guo A (2006) CST Curation Set: 1510; Year: 2006; Biosample/Treatment: cell line, SKOV-3/serum starved; Disease: ovarian epithelial carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SKOV-3 (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1511; Year: 2006; Biosample/Treatment: cell line, ES2/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: ES2 (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1513; Year: 2006; Biosample/Treatment: cell line, TOV112D/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: TOV112D (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1514; Year: 2006; Biosample/Treatment: cell line, OV90/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: OV90 (ovarian) Treatments: serum_starvation |
|
Guo A (2006) CST Curation Set: 1515; Year: 2006; Biosample/Treatment: cell line, Detroit562/serum starved; Disease: squamous cell carcinoma of the oropharynx; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Detroit562 (squamous) Treatments: serum_starvation |
|
Gu T (2006) CST Curation Set: 1503; Year: 2006; Biosample/Treatment: cell line, Reh/untreated; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Reh (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1505; Year: 2006; Biosample/Treatment: cell line, RS4;11/untreated; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: RS4;11 (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1508; Year: 2006; Biosample/Treatment: cell line, HEL/untreated; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Gu T (2006) CST Curation Set: 1509; Year: 2006; Biosample/Treatment: cell line, HEL/untreated; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Moritz A (2006) CST Curation Set: 1494; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1495; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1496; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1497; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1498; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1499; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1500; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1501; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Li Y (2006) CST Curation Set: 1477; Year: 2006; Biosample/Treatment: cell line, HCT8/untreated &'||' TSA; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCT8 (intestinal) Treatments: trichostatin_A |
|
Moritz A (2006) CST Curation Set: 1461; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1462; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1463; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1464; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Gu T (2006) CST Curation Set: 1456; Year: 2006; Biosample/Treatment: bone marrow, myeloid/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: myeloid-bone marrow |
|
Moritz A (2006) CST Curation Set: 1436; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1437; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1439; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1440; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1441; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1442; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1438; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Guo A (2006) CST Curation Set: 1430; Year: 2006; Biosample/Treatment: tissue, lung/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Moritz A (2006) CST Curation Set: 1418; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1419; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1420; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1421; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1422; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2006) CST Curation Set: 1424; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Gu T (2006) CST Curation Set: 1410; Year: 2006; Biosample/Treatment: cell line, Mono Mac 6/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Mono Mac 6 (myeloid) |
|
Gu T (2006) CST Curation Set: 1412; Year: 2006; Biosample/Treatment: cell line, Molm 14/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Molm 14 (myeloid) |
|
Gu T (2006) CST Curation Set: 1413; Year: 2006; Biosample/Treatment: cell line, MV4-11/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) |
|
Gu T (2006) CST Curation Set: 1414; Year: 2006; Biosample/Treatment: cell line, NKM-1/untreated; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NKM-1 (myeloid) |
|
Gu T (2006) CST Curation Set: 1415; Year: 2006; Biosample/Treatment: cell line, SEM/untreated; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SEM (B lymphocyte) |
|
Yu J (2006) CST Curation Set: 1392; Year: 2006; Biosample/Treatment: cell line, Kyse270/-; Disease: esophageal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Kyse270 (esophageal) |
|
Yu J (2006) CST Curation Set: 1395; Year: 2006; Biosample/Treatment: cell line, Kyse510/-; Disease: esophageal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Kyse510 (esophageal) |
|
Yu J (2006) CST Curation Set: 1394; Year: 2006; Biosample/Treatment: cell line, Kyse450/-; Disease: esophageal cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Kyse450 (squamous) |
|
Stokes M (2006) CST Curation Set: 1378; Year: 2006; Biosample/Treatment: cell line, A172/serum starved; Disease: glioblastoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: A172 (glial) Treatments: serum_starvation |
|
Stokes M (2006) CST Curation Set: 1379; Year: 2006; Biosample/Treatment: cell line, A172/serum starved; Disease: glioblastoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: A172 (glial) Treatments: serum_starvation |
|
Stokes M (2006) CST Curation Set: 1381; Year: 2006; Biosample/Treatment: cell line, 68-ES-9908/serum starved; Disease: glioblastoma multiforme; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Yu J (2006) CST Curation Set: 1369; Year: 2006; Biosample/Treatment: cell line, Jurkat/serum starved &'||' pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: vanadate |
|
Yu J (2006) CST Curation Set: 1393; Year: 2006; Biosample/Treatment: cell line, Kyse410/-; Disease: esophageal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Kyse410 (esophageal) |
|
Rikova K (2006) CST Curation Set: 1284; Year: 2006; Biosample/Treatment: cell line, NCI-H2066/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2066 (pulmonary) Treatments: serum_starvation |
|
Gu T (2006) CST Curation Set: 1277; Year: 2006; Biosample/Treatment: bone marrow, myeloid/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: myeloid-bone marrow |
|
Gu T (2006) CST Curation Set: 1276; Year: 2006; Biosample/Treatment: bone marrow, myeloid/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: myeloid-bone marrow |
|
Li Y (2006) CST Curation Set: 1264; Year: 2006; Biosample/Treatment: cell line, SW620/untreated; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW620 (intestinal) |
|
Gu T (2006) CST Curation Set: 1237; Year: 2006; Biosample/Treatment: cell line, VAL/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: VAL (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1238; Year: 2006; Biosample/Treatment: cell line, RI-1/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: RI-1 (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1221; Year: 2006; Biosample/Treatment: cell line, RC-K8/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: RC-K8 (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1222; Year: 2006; Biosample/Treatment: cell line, Pfeiffer/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Pfeiffer (B lymphocyte) |
|
Gu T (2006) CST Curation Set: 1223; Year: 2006; Biosample/Treatment: cell line, Karpas-1106P/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Karpas-1106P (B lymphocyte) |
|
Moritz A (2006) CST Curation Set: 1224; Year: 2006; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Gu T (2006) CST Curation Set: 1197; Year: 2006; Biosample/Treatment: cell line, Z-55/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Z-55 (myeloid) |
|
Gu T (2006) CST Curation Set: 1174; Year: 2006; Biosample/Treatment: cell line, MO-91/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MO-91 (myeloid) |
|
Gu T (2006) CST Curation Set: 1175; Year: 2006; Biosample/Treatment: cell line, MO-91/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MO-91 (myeloid) |
|
Gu T (2006) CST Curation Set: 1177; Year: 2006; Biosample/Treatment: bone marrow, myeloid/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: myeloid-bone marrow |
|
Stokes M (2006) CST Curation Set: 1163; Year: 2006; Biosample/Treatment: cell line, 8-MG-BA/serum starved; Disease: glioblastoma multiforme; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: 8-MG-BA (glial) Treatments: serum_starvation |
|
Stokes M (2006) CST Curation Set: 1154; Year: 2006; Biosample/Treatment: cell line, SKNSH/serum starved; Disease: neuroblastoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SKNSH (neural crest) Treatments: serum_starvation |
|
Gu T (2006) CST Curation Set: 1129; Year: 2006; Biosample/Treatment: cell line, DND-41/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DND-41 (T lymphocyte) |
|
Gu T (2006) CST Curation Set: 1130; Year: 2006; Biosample/Treatment: cell line, DND-41/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DND-41 (T lymphocyte) |
|
Gu T (2006) CST Curation Set: 1132; Year: 2006; Biosample/Treatment: cell line, KOPT-K1/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KOPT-K1 (T lymphocyte) |
|
Gu T (2006) CST Curation Set: 1133; Year: 2006; Biosample/Treatment: cell line, KG-1/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KG-1 (myeloid) |
|
Gu T (2006) CST Curation Set: 1134; Year: 2006; Biosample/Treatment: cell line, KG-1/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KG-1 (myeloid) |
|
Possemato A (2006) CST Curation Set: 1113; Year: 2006; Biosample/Treatment: cell line, HCC1500/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC1500 (breast cell) Treatments: serum_starvation |
|
Possemato A (2006) CST Curation Set: 1114; Year: 2006; Biosample/Treatment: cell line, NCI-H1915/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1915 (pulmonary) Treatments: serum_starvation |
|
Possemato A (2006) CST Curation Set: 1115; Year: 2006; Biosample/Treatment: cell line, NCI-H2228/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2228 (pulmonary) Treatments: serum_starvation |
|
Possemato A (2006) CST Curation Set: 1116; Year: 2006; Biosample/Treatment: cell line, LOU-NH91/serum starved; Disease: non-small cell squamous cell lung carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: LOU-NH91 (squamous) Treatments: serum_starvation |
|
Possemato A (2006) CST Curation Set: 1117; Year: 2006; Biosample/Treatment: cell line, NCI-H810/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H810 (pulmonary) Treatments: serum_starvation |
|
Possemato A (2006) CST Curation Set: 1118; Year: 2006; Biosample/Treatment: cell line, HCC78/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC78 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1104; Year: 2006; Biosample/Treatment: cell line, NCI-H647/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H647 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1105; Year: 2006; Biosample/Treatment: cell line, NCI-H596/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H596 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2006) CST Curation Set: 1106; Year: 2006; Biosample/Treatment: cell line, NCI-H1838/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1838 (pulmonary) Treatments: serum_starvation |
|
Stokes M (2006) CST Curation Set: 1090; Year: 2006; Biosample/Treatment: cell line, SW1783/serum starved; Disease: astrocytoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW1783 (glial) Treatments: serum_starvation |
|
Farnsworth C (2006) CST Curation Set: 1078; Year: 2006; Biosample/Treatment: cell line, DMS153/serum starved &'||' 10% serum; Disease: small-cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DMS153 (pulmonary) |
|
Farnsworth C (2006) CST Curation Set: 1079; Year: 2006; Biosample/Treatment: cell line, DMS153/serum starved &'||' conditined media; Disease: small-cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DMS153 (pulmonary) |
|
Rikova K (2006) CST Curation Set: 1075; Year: 2006; Biosample/Treatment: cell line, NCI-H2030/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2030 (pulmonary) Treatments: serum_starvation |
|
Stokes M (2006) CST Curation Set: 1071; Year: 2006; Biosample/Treatment: cell line, M059J/serum starved; Disease: glioblastoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: M059J (glial) Treatments: serum_starvation |
|
Moritz A (2005) CST Curation Set: 1044; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2005) CST Curation Set: 1045; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2005) CST Curation Set: 1046; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2005) CST Curation Set: 1047; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2005) CST Curation Set: 1048; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2005) CST Curation Set: 1049; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Rikova K (2005) CST Curation Set: 985; Year: 2005; Biosample/Treatment: cell line, NCI-H1435/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1435 (pulmonary) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 998; Year: 2005; Biosample/Treatment: cell line, VACO432/mutBRaf; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: VACO432 (ovarian) |
|
Guo A (2005) CST Curation Set: 999; Year: 2005; Biosample/Treatment: cell line, RKO/mutBRaf; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: RKO (intestinal) |
|
Mitchell J (2005) CST Curation Set: 982; Year: 2005; Biosample/Treatment: cell line, NCI-H1563/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1563 (pulmonary) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 981; Year: 2005; Biosample/Treatment: tissue, lung/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Stokes M (2005) CST Curation Set: 973; Year: 2005; Biosample/Treatment: cell line, DBTRG-05MG/serum starved; Disease: glioblastoma multiforme; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DBTRG-05MG (glial) Treatments: serum_starvation |
|
Spek E (2005) CST Curation Set: 972; Year: 2005; Biosample1/Treatment/Isotope: cell line, K562/none/L, Biosample2/Treatment/Isotope: cell line, K562/Gleevec/H; Disease: chronic myelogenous leukemia; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Goss V (2005) CST Curation Set: 963; Year: 2005; Biosample1/Treatment/Isotope: cell line, HEL/Jak Inhibitor I/L, Biosample2/Treatment/Isotope: cell line, HEL/none/H; Disease: erythroid leukemia; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Stokes M (2005) CST Curation Set: 965; Year: 2005; Biosample/Treatment: cell line, T98G/serum starved; Disease: glioblastoma multiforme; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: T98G (glial) Treatments: serum_starvation |
|
Rikova K (2005) CST Curation Set: 962; Year: 2005; Biosample/Treatment: cell line, NCI-H1869/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1869 (squamous) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 948; Year: 2005; Biosample/Treatment: tissue, lung/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Goss V (2005) CST Curation Set: 941; Year: 2005; Biosample/Treatment: cell line, OCI-M1/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: OCI-M1 (myeloid) |
|
Goss V (2005) CST Curation Set: 943; Year: 2005; Biosample/Treatment: cell line, HEL/-; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Guo A (2005) CST Curation Set: 933; Year: 2005; Biosample/Treatment: cell line, NCI-H1734/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1734 (pulmonary) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 934; Year: 2005; Biosample/Treatment: cell line, LOU-NH91/serum starved; Disease: non-small cell squamous cell lung carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: LOU-NH91 (squamous) Treatments: serum_starvation |
|
Possemato A (2005) CST Curation Set: 913; Year: 2005; Biosample/Treatment: cell line, NCI-H1299/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1299 (pulmonary) Treatments: serum_starvation |
|
Possemato A (2005) CST Curation Set: 914; Year: 2005; Biosample/Treatment: cell line, NCI-H1648/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1648 (pulmonary) Treatments: serum_starvation |
|
Stokes M (2005) CST Curation Set: 915; Year: 2005; Biosample/Treatment: cell line, NCI-H1651/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1651 (pulmonary) Treatments: serum_starvation |
|
Stokes M (2005) CST Curation Set: 916; Year: 2005; Biosample/Treatment: cell line, M059K/serum starved; Disease: glioblastoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: M059K (glial) Treatments: serum_starvation |
|
Rikova K (2005) CST Curation Set: 917; Year: 2005; Biosample/Treatment: cell line, NCI-H2023/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2023 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2005) CST Curation Set: 901; Year: 2005; Biosample/Treatment: cell line, NCI-H1793/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1793 (pulmonary) Treatments: serum_starvation |
|
Spek E (2005) CST Curation Set: 899; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Guo A (2005) CST Curation Set: 882; Year: 2005; Biosample/Treatment: cell line, NCI-H358/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H358 (pulmonary) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 885; Year: 2005; Biosample/Treatment: cell line, NCI-H1666/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1666 (pulmonary) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 886; Year: 2005; Biosample/Treatment: cell line, HCC827/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC827 (pulmonary) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 887; Year: 2005; Biosample/Treatment: cell line, Calu-3/serum starved; Disease: lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Calu-3 (pulmonary) Treatments: serum_starvation |
|
Gu T (2005) CST Curation Set: 874; Year: 2005; Biosample/Treatment: cell line, KMS-18/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KMS-18 (B lymphocyte) |
|
Gu T (2005) CST Curation Set: 875; Year: 2005; Biosample/Treatment: cell line, KMS-11/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KMS-11 (B lymphocyte) |
|
Gu T (2005) CST Curation Set: 863; Year: 2005; Biosample/Treatment: cell line, Molm 14/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Molm 14 (myeloid) |
|
Gu T (2005) CST Curation Set: 842; Year: 2005; Biosample/Treatment: cell line, CHRF/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CHRF (megakaryocyte) |
|
Gu T (2005) CST Curation Set: 836; Year: 2005; Biosample/Treatment: cell line, KY821/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KY821 (myeloid) |
|
Rikova K (2005) CST Curation Set: 832; Year: 2005; Biosample/Treatment: cell line, NCI-H520/serum starved; Disease: non-small cell squamous cell lung carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H520 (squamous) Treatments: serum_starvation |
|
Rikova K (2005) CST Curation Set: 833; Year: 2005; Biosample/Treatment: cell line, NCI-H520/serum starved; Disease: non-small cell squamous cell lung carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H520 (squamous) Treatments: serum_starvation |
|
Li Y (2005) CST Curation Set: 834; Year: 2005; Biosample/Treatment: cell line, SW480/serum starved; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW480 (intestinal) Treatments: serum_starvation |
|
Li Y (2005) CST Curation Set: 835; Year: 2005; Biosample/Treatment: cell line, SW620/serum starved; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW620 (intestinal) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 831; Year: 2005; Biosample/Treatment: tissue, lung/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Spek E (2005) CST Curation Set: 819; Year: 2005; Biosample/Treatment: cell line, HT-29/-; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HT-29 (intestinal) |
|
Gu T (2005) CST Curation Set: 817; Year: 2005; Biosample/Treatment: cell line, NOMO-1/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NOMO-1 (myeloid) |
|
Gu T (2005) CST Curation Set: 818; Year: 2005; Biosample/Treatment: cell line, NKM-1/-; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NKM-1 (myeloid) |
|
Gu T (2005) CST Curation Set: 892; Year: 2005; Biosample/Treatment: cell line, Mono Mac 6/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Mono Mac 6 (myeloid) |
|
Possemato A (2005) CST Curation Set: 805; Year: 2005; Biosample/Treatment: cell line, NCI-H1568/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1568 (pulmonary) Treatments: serum_starvation |
|
Possemato A (2005) CST Curation Set: 806; Year: 2005; Biosample/Treatment: cell line, NCI-H1437/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1437 (pulmonary) Treatments: serum_starvation |
|
Mitchell J (2005) CST Curation Set: 777; Year: 2005; Biosample/Treatment: cell line, NCI-H1944/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1944 (pulmonary) Treatments: serum_starvation |
|
Mitchell J (2005) CST Curation Set: 778; Year: 2005; Biosample/Treatment: cell line, HCC78/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC78 (pulmonary) Treatments: serum_starvation |
|
Mitchell J (2005) CST Curation Set: 779; Year: 2005; Biosample/Treatment: cell line, HCC44/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC44 (pulmonary) Treatments: serum_starvation |
|
Mitchell J (2005) CST Curation Set: 774; Year: 2005; Biosample/Treatment: cell line, T47D/serum starved; Disease: breast ductal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: T47D (breast cell) Treatments: serum_starvation |
|
Guo A (2005) CST Curation Set: 769; Year: 2005; Biosample/Treatment: tissue, lung/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Boccalatte F (2005) CST Curation Set: 755; Year: 2005; Biosample/Treatment: cell line, Mac1/-; Disease: anaplastic large cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Mac1 (T lymphocyte) |
|
Guo A (2005) CST Curation Set: 763; Year: 2005; Biosample/Treatment: tissue, lung/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Gu T (2005) CST Curation Set: 753; Year: 2005; Biosample/Treatment: cell line, MCF-10A/-; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MCF-10A (breast cell) |
|
Mitchell J (2005) CST Curation Set: 736; Year: 2005; Biosample/Treatment: cell line, MDA-MB453/serum starved; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-453 (breast cell) Treatments: serum_starvation |
|
Possemato A (2005) CST Curation Set: 1189; Year: 2005; Biosample/Treatment: cell line, A172/serum starved; Disease: glioblastoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: A172 (glial) Treatments: serum_starvation |
|
Gu T (2005) CST Curation Set: 730; Year: 2005; Biosample/Treatment: cell line, DU.528/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DU.528 ('stem, hematopoietic') |
|
Gu T (2005) CST Curation Set: 731; Year: 2005; Biosample/Treatment: cell line, SUP-T13/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SUP-T13 (T lymphocyte) |
|
Gu T (2005) CST Curation Set: 732; Year: 2005; Biosample/Treatment: cell line, MOLT-15/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MOLT-15 (myeloid) |
|
Rikova K (2005) CST Curation Set: 733; Year: 2005; Biosample/Treatment: cell line, NCI-H2228/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2228 (pulmonary) Treatments: serum_starvation |
|
Farnsworth C (2005) CST Curation Set: 735; Year: 2005; Biosample/Treatment: cell line, DMS53/serum starved; Disease: small-cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DMS53 (pulmonary) Treatments: serum_starvation |
|
Gu T (2005) CST Curation Set: 722; Year: 2005; Biosample/Treatment: cell line, HU-3/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HU-3 (myeloid) |
|
Gu T (2005) CST Curation Set: 714; Year: 2005; Biosample/Treatment: cell line, UT-7/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: UT-7 (myeloid) |
|
Gu T (2005) CST Curation Set: 715; Year: 2005; Biosample/Treatment: cell line, CMK/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CMK (megakaryoblast) |
|
Gu T (2005) CST Curation Set: 716; Year: 2005; Biosample/Treatment: cell line, MKPL-1/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MKPL-1 (megakaryoblast) |
|
Rikova K (2005) CST Curation Set: 695; Year: 2005; Biosample/Treatment: cell line, NCI-H1703/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1703 (squamous) Treatments: serum_starvation |
|
Goss V (2005) CST Curation Set: 671; Year: 2005; Biosample/Treatment: cell line, KCL22/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KCL22 (myeloid) |
|
Goss V (2005) CST Curation Set: 672; Year: 2005; Biosample/Treatment: cell line, KCL22/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KCL22 (myeloid) |
|
Goss V (2005) CST Curation Set: 673; Year: 2005; Biosample/Treatment: cell line, SD1/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SD1 (lymphoblastoid) |
|
Farnsworth C (2005) CST Curation Set: 719; Year: 2005; Biosample/Treatment: tissue, lung/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: lung |
|
Goss V (2005) CST Curation Set: 668; Year: 2005; Biosample/Treatment: cell line, SUP-B15/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SUP-B15 (B lymphocyte) |
|
Moritz A (2005) CST Curation Set: 656; Year: 2005; Biosample/Treatment: cell line, HT-29/-; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HT-29 (intestinal) |
|
Moritz A (2005) CST Curation Set: 657; Year: 2005; Biosample/Treatment: cell line, HT-29/-; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HT-29 (intestinal) |
|
Goss V (2005) CST Curation Set: 667; Year: 2005; Biosample/Treatment: cell line, KU812/-; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KU812 (myeloid) |
|
Guo A (2005) CST Curation Set: 638; Year: 2005; Biosample/Treatment: cell line, A549/serum starved; Disease: lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: A549 (pulmonary) Treatments: serum_starvation |
|
Li Y (2005) CST Curation Set: 648; Year: 2005; Biosample/Treatment: cell line, HCT116/-; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCT116 (intestinal) |
|
Li Y (2005) CST Curation Set: 649; Year: 2005; Biosample/Treatment: cell line, HCT116/cyclodextrin; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCT116 (intestinal) |
|
Spek E (2005) CST Curation Set: 627; Year: 2005; Biosample/Treatment: cell line, N87/serum starved &'||' EGF; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: N87 (gastric) Treatments: serum_starvation, EGF |
|
Gu T (2005) CST Curation Set: 628; Year: 2005; Biosample/Treatment: cell line, SEM/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SEM (B lymphocyte) |
|
Spek E (2005) CST Curation Set: 626; Year: 2005; Biosample/Treatment: cell line, HT-29/-; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HT-29 (intestinal) |
|
Boccalatte F (2005) CST Curation Set: 614; Year: 2005; Biosample/Treatment: cell line, Karpas-299/-; Disease: T cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Karpas-299 (T lymphocyte) |
|
Guo A (2005) CST Curation Set: 621; Year: 2005; Biosample/Treatment: cell line, NCI-H2347/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2347 (pulmonary) Treatments: serum_starvation |
|
Rikova K (2005) CST Curation Set: 613; Year: 2005; Biosample/Treatment: cell line, NCI-H2170/serum starved; Disease: non-small cell squamous cell lung carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H2170 (squamous) Treatments: serum_starvation |
|
Mitchell J (2005) CST Curation Set: 603; Year: 2005; Biosample/Treatment: cell line, NCI-H358/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H358 (pulmonary) Treatments: serum_starvation |
|
Moritz A (2005) CST Curation Set: 585; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2005) CST Curation Set: 586; Year: 2005; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Gu T (2005) CST Curation Set: 583; Year: 2005; Biosample/Treatment: cell line, MCF-10A/su 6656; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MCF-10A (breast cell) Treatments: SU6656 |
|
Gu T (2005) CST Curation Set: 584; Year: 2005; Biosample/Treatment: cell line, MCF-10A/-; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MCF-10A (breast cell) |
|
Farnsworth C (2005) CST Curation Set: 574; Year: 2005; Biosample/Treatment: cell line, NCI-H196/EGF; Disease: small-cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H196 (pulmonary) Treatments: EGF |
|
Rikova K (2005) CST Curation Set: 548; Year: 2005; Biosample/Treatment: cell line, Calu-3/serum starved; Disease: lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Calu-3 (pulmonary) Treatments: serum_starvation |
|
Boccalatte F (2005) CST Curation Set: 538; Year: 2005; Biosample/Treatment: cell line, SUP-M2/-; Disease: anaplastic large cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SUP-M2 (T lymphocyte) |
|
Guo A (2005) CST Curation Set: 524; Year: 2005; xenograft, Biosample/Treatment: cell line, NCI-H1703/untreated; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1703 (squamous) |
|
Gu T (2005) CST Curation Set: 520; Year: 2005; Biosample/Treatment: cell line, MV4-11/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MV4-11 (macrophage) |
|
Gu T (2005) CST Curation Set: 516; Year: 2005; Biosample/Treatment: cell line, Molm 14/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Molm 14 (myeloid) |
|
Gu T (2005) CST Curation Set: 515; Year: 2005; Biosample/Treatment: cell line, SEM/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SEM (B lymphocyte) |
|
Moritz A (2004) CST Curation Set: 623; Year: 2004; Biosample1/Treatment/Isotope: cell line, NCI-H1650/EGF/L, Biosample2/Treatment/Isotope: cell line, NCI-H1650/EGF/Iressa/H; Disease: non-small cell lung cancer; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H1650 (pulmonary) Treatments: gefitinib, EGF |
|
Gu T (2004) CST Curation Set: 498; Year: 2004; Biosample/Treatment: cell line, MCF-10A/-; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MCF-10A (breast cell) |
|
Farnsworth C (2004) CST Curation Set: 491; Year: 2004; Biosample/Treatment: cell line, DMS153/serum starved; Disease: small-cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DMS153 (pulmonary) Treatments: serum_starvation |
|
Farnsworth C (2004) CST Curation Set: 607; Year: 2004; Biosample/Treatment: cell line, NCI-H69/0.1% serum; Disease: small-cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H69 (pulmonary) Treatments: serum_starvation |
|
Goss V (2004) CST Curation Set: 465; Year: 2004; Biosample/Treatment: cell line, BV-173/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BV-173 (myeloid) |
|
Farnsworth C (2004) CST Curation Set: 445; Year: 2004; Biosample/Treatment: cell line, NCI-H526/-; Disease: small-cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H526 (pulmonary) |
|
Spek E (2004) CST Curation Set: 406; Year: 2004; Biosample/Treatment: cell line, Jurkat/pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: vanadate |
|
Spek E (2004) CST Curation Set: 409; Year: 2004; Biosample/Treatment: cell line, Jurkat/pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: vanadate |
|
Moritz A (2004) CST Curation Set: 410; Year: 2004; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Guo A (2004) CST Curation Set: 414; Year: 2004; Biosample/Treatment: cell line, Hs766T/Serum starved; Disease: pancreatic carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Hs766T (pancreatic) Treatments: serum_starvation |
|
Goss V (2004) CST Curation Set: 402; Year: 2004; Biosample/Treatment: cell line, HEL/-; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Li Y (2004) CST Curation Set: 389; Year: 2004; Biosample/Treatment: cell line, HCT116/Serum starved &'||' EGF; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCT116 (intestinal) Treatments: EGF, serum_starvation |
|
Li Y (2004) CST Curation Set: 362; Year: 2004; Biosample/Treatment: cell line, HCT116/Serum starved; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCT116 (intestinal) Treatments: serum_starvation |
|
Guo A (2004) CST Curation Set: 367; Year: 2004; Biosample/Treatment: cell line, PANC-1/EGF; Disease: pancreatic carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: PANC-1 (pancreatic) Treatments: EGF |
|
Li Y (2004) CST Curation Set: 361; Year: 2004; Biosample/Treatment: cell line, SW620/Serum starved &'||' IGF; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW620 (intestinal) Treatments: serum_starvation, IGF-1 |
|
Goss V (2004) CST Curation Set: 349; Year: 2004; Biosample/Treatment: cell line, SUP-B15/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SUP-B15 (B lymphocyte) |
|
Goss V (2004) CST Curation Set: 350; Year: 2004; Biosample/Treatment: cell line, KU812/-; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: KU812 (myeloid) |
|
Rikova K (2004) CST Curation Set: 314; Year: 2004; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Rikova K (2004) CST Curation Set: 315; Year: 2004; Biosample/Treatment: cell line, NCI-H441/EGF; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: NCI-H441 (pulmonary) Treatments: EGF |
|
Goss V (2004) CST Curation Set: 353; Year: 2004; Biosample/Treatment: cell line, HT-29/EGF; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HT-29 (intestinal) Treatments: EGF |
|
Goss V (2004) CST Curation Set: 300; Year: 2004; Biosample1/Treatment/Isotope: cell line, EOL-1/none/L, Biosample2/Treatment/Isotope: cell line, EOL-1/Gleevec/H; Disease: acute myelogenous leukemia; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: EOL-1 (myeloid) Treatments: imatinib |
|
Moritz A (2004) CST Curation Set: 387; Year: 2004; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: K562 (erythroid) |
|
Goss V (2004) CST Curation Set: 279; Year: 2004; Biosample/Treatment: cell line, M01043/-; Disease: chronic lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MO1043 (B lymphocyte) |
|
Goss V (2004) CST Curation Set: 258; Year: 2004; Biosample1/Treatment/Isotope: cell line, EOL-1/none/L, Biosample2/Treatment/Isotope: cell line, EOL-1/Gleevec/H; Disease: acute myelogenous leukemia; SILAC: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: EOL-1 (myeloid) Treatments: imatinib |
|
Guo A (2004) CST Curation Set: 248; Year: 2004; Biosample/Treatment: cell line, BxPC-3/-; Disease: pancreatic carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BxPC-3 (pancreatic) |
|
Guo A (2004) CST Curation Set: 253; Year: 2004; Biosample/Treatment: cell line, BxPC-3/EGF; Disease: pancreatic carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BxPC-3 (pancreatic) Treatments: EGF |
|
Moritz A (2003) CST Curation Set: 195; Year: 2003; Biosample/Treatment: cell line, MDA-MB468/EGF; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-468 (breast cell) Treatments: EGF |
|
Moritz A (2003) CST Curation Set: 198; Year: 2003; Biosample/Treatment: cell line, MDA-MB468/-; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-468 (breast cell) |
|
Moritz A (2003) CST Curation Set: 199; Year: 2003; Biosample/Treatment: cell line, MDA-MB468/EGF &'||' Iressa; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-468 (breast cell) Treatments: gefitinib, EGF |
|
Moritz A (2003) CST Curation Set: 200; Year: 2003; Biosample/Treatment: cell line, MDA-MB468/EGF &'||' Iressa; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-468 (breast cell) Treatments: gefitinib, EGF |
|
Moritz A (2003) CST Curation Set: 201; Year: 2003; Biosample/Treatment: cell line, MDA-MB468/EGF &'||' Iressa; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-468 (breast cell) Treatments: gefitinib, EGF |
|
Moritz A (2003) CST Curation Set: 202; Year: 2003; Biosample/Treatment: cell line, MDA-MB468/EGF &'||' Tarceva; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-468 (breast cell) Treatments: erlotinib, EGF |
|
Moritz A (2003) CST Curation Set: 203; Year: 2003; Biosample/Treatment: cell line, MDA-MB468/EGF &'||' Tarceva; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-468 (breast cell) Treatments: erlotinib, EGF |
|
Moritz A (2003) CST Curation Set: 204; Year: 2003; Biosample/Treatment: cell line, MDA-MB468/EGF &'||' Tarceva; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MDA-MB-468 (breast cell) Treatments: erlotinib, EGF |