Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus® v6.5.9.3
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Thr842  - Pyk2 (human)

PeptideReferences 
SLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR 1, 2, 3, 4, 5, 6, 7 View spectrum

References 

1

Gu T (2007) CST Curation Set: 2586; Year: 2007; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: PXpTPAntibodies Used to Purify Peptides prior to LCMS: Phospho-MAPK Substrates (PXTP) (46G11) Rabbit mAb Cat#: 4391, PTMScan(R) Phospho-MAPK Substrate Motif (PXpTP) Immunoaffinity Beads Cat#: 1983
Cell Line/Tissue: bone marrow

2

Gu T (2007) CST Curation Set: 2590; Year: 2007; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: PXpTPAntibodies Used to Purify Peptides prior to LCMS: Phospho-MAPK Substrates (PXTP) (46G11) Rabbit mAb Cat#: 4391, PTMScan(R) Phospho-MAPK Substrate Motif (PXpTP) Immunoaffinity Beads Cat#: 1983

3

Gu T (2007) CST Curation Set: 2591; Year: 2007; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: PXpTPAntibodies Used to Purify Peptides prior to LCMS: Phospho-MAPK Substrates (PXTP) (46G11) Rabbit mAb Cat#: 4391, PTMScan(R) Phospho-MAPK Substrate Motif (PXpTP) Immunoaffinity Beads Cat#: 1983

4

Gu T (2007) CST Curation Set: 2594; Year: 2007; Biosample/Treatment: tissue, bone marrow/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: PXpTPAntibodies Used to Purify Peptides prior to LCMS: Phospho-MAPK Substrates (PXTP) (46G11) Rabbit mAb Cat#: 4391, PTMScan(R) Phospho-MAPK Substrate Motif (PXpTP) Immunoaffinity Beads Cat#: 1983
Cell Line/Tissue: bone marrow

5

Moritz A (2006) CST Curation Set: 1836; Year: 2006; Biosample/Treatment: cell line, SEM/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: PXpTPAntibodies Used to Purify Peptides prior to LCMS: Phospho-MAPK Substrates (PXTP) (46G11) Rabbit mAb Cat#: 4391, PTMScan(R) Phospho-MAPK Substrate Motif (PXpTP) Immunoaffinity Beads Cat#: 1983
Cell Line/Tissue: SEM (B lymphocyte)

6

Moritz A (2006) CST Curation Set: 1824; Year: 2006; Biosample/Treatment: cell line, SEM/Flt3 inhibitor; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: PXpTPAntibodies Used to Purify Peptides prior to LCMS: Phospho-MAPK Substrates (PXTP) (46G11) Rabbit mAb Cat#: 4391, PTMScan(R) Phospho-MAPK Substrate Motif (PXpTP) Immunoaffinity Beads Cat#: 1983
Cell Line/Tissue: SEM (B lymphocyte)
Treatments:  Flt3_inhibitor

7

Moritz A (2006) CST Curation Set: 1826; Year: 2006; Biosample/Treatment: cell line, SEM/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: PXpTPAntibodies Used to Purify Peptides prior to LCMS: Phospho-MAPK Substrates (PXTP) (46G11) Rabbit mAb Cat#: 4391, PTMScan(R) Phospho-MAPK Substrate Motif (PXpTP) Immunoaffinity Beads Cat#: 1983
Cell Line/Tissue: SEM (B lymphocyte)