|
Powered by Cell Signaling Technology |
Peptide | References | |
---|---|---|
AYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQK | 1, 2 | View spectrum |
References | |
---|---|
Stokes M (2006) CST Curation Set: 1616; Year: 2006; Biosample/Treatment: cell line, M059K/UV; Disease: glioblastoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: p[ST]Q Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) ATM/ATR Substrate Antibody Cat#: 2851
Cell Line/Tissue: M059K (glial) Treatments: UV |
|
Stokes M (2006) CST Curation Set: 1617; Year: 2006; Biosample/Treatment: cell line, M059K/UV; Disease: glioblastoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: p[ST]Q Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) ATM/ATR Substrate Antibody Cat#: 2851
Cell Line/Tissue: M059K (glial) Treatments: UV |