|
Powered by Cell Signaling Technology |
|
Powered by Cell Signaling Technology |
| Peptide | References | |
|---|---|---|
| GQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYER | 1, 2 | View spectrum |
| References | |
|---|---|
| Possemato A (2007) CST Curation Set: 3233; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: p[ST]P , PTMScan(R) PLK Binding Motif (SpTP) Immunoaffinity Beads Cat#: 1995 | |
|
Possemato A (2006) CST Curation Set: 1664; Year: 2006; Biosample/Treatment: cell line, NCI-H1703/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: p[ST]P , PTMScan(R) PLK Binding Motif (SpTP) Immunoaffinity Beads Cat#: 1995
Cell Line/Tissue: NCI-H1703 (squamous) Treatments: serum_starvation |
Developed with grants from
|
and literature mining with Linguamatics
|
PhosphoSite, created by Cell Signaling Technology is licensed under a Creative
Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License.
|
©2003-2019 Cell Signaling Technology, Inc.
