|
Powered by Cell Signaling Technology |
Peptide | References | |
---|---|---|
AKLTDPKEDPIYDEPEGLAPVPPQGLYDLPR | 10, 11, 13 | View spectrum |
AKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPK | 1, 2, 5, 10, 11, 14 | View spectrum |
LTDPKEDPIYDEPEGLAPVPPQGLYDLPR | 3, 5, 6, 7, 9, 10, 11, 12, 14 | View spectrum |
LTDPKEDPIYDEPEGLAPVPPQGLYDLPREPK | 1, 2, 4, 8, 10, 11, 13, 14 | View spectrum |
References | |
---|---|
Gu T (2006) CST Curation Set: 1962; Year: 2006; Biosample/Treatment: cell line, CMS/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CMS (myeloid) |
|
Gu T (2006) CST Curation Set: 1963; Year: 2006; Biosample/Treatment: cell line, CMS/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CMS (myeloid) |
|
Gu T (2006) CST Curation Set: 1875; Year: 2006; Biosample/Treatment: cell line, CMS/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CMS (myeloid) |
|
Gu T (2006) CST Curation Set: 1876; Year: 2006; Biosample/Treatment: cell line, CMS/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CMS (myeloid) |
|
Moritz A (2006) CST Curation Set: 1781; Year: 2006; Biosample/Treatment: cell line, HEL/Flt3 inhibitor; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Moritz A (2006) CST Curation Set: 1783; Year: 2006; Biosample/Treatment: cell line, HEL/-; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Guo A (2006) CST Curation Set: 1561; Year: 2006; Biosample/Treatment: cell line, OV90/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: OV90 (ovarian) Treatments: serum_starvation |
|
Gu T (2006) CST Curation Set: 1557; Year: 2006; Biosample/Treatment: cell line, MKPL-1/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MKPL-1 (megakaryoblast) |
|
Guo A (2006) CST Curation Set: 1514; Year: 2006; Biosample/Treatment: cell line, OV90/serum starved; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: OV90 (ovarian) Treatments: serum_starvation |
|
Gu T (2006) CST Curation Set: 1508; Year: 2006; Biosample/Treatment: cell line, HEL/untreated; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Gu T (2006) CST Curation Set: 1509; Year: 2006; Biosample/Treatment: cell line, HEL/untreated; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Gu T (2006) CST Curation Set: 1223; Year: 2006; Biosample/Treatment: cell line, Karpas-1106P/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Karpas-1106P (B lymphocyte) |
|
Goss V (2005) CST Curation Set: 943; Year: 2005; Biosample/Treatment: cell line, HEL/-; Disease: erythroid leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HEL (erythroid) |
|
Gu T (2005) CST Curation Set: 722; Year: 2005; Biosample/Treatment: cell line, HU-3/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HU-3 (myeloid) |