|
Powered by Cell Signaling Technology |
Peptide | References | |
---|---|---|
RRSTGVSFWTQDSDENEQEQQSDTEEGSNKK | 1, 2, 3 | 18339 View spectrum 20227 View spectrum 20327 View spectrum |
References | |
---|---|
Rikova K, Hall B (2013) CST Curation Set: 20736, 21163, 30158, 30159, 30160; Year: 2013; Biosample/Treatment: cell line, A549, H1355, H23, H441, H1792; Disease: -; TMT: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY, p[ST], RXXp[ST], pSQ, p[ST]QG, LXRXXp[ST], p[ST]P | |
Rikova K, Hall B (2013) CST Curation Set: 20738, 21165, 30164, 30165, 30166; Year: 2013; Biosample/Treatment: cell line, H1650, HCC827, H1975, Calu-3, H2106; Disease: -; TMT: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY, p[ST], RXXp[ST], pSQ, p[ST]QG, LXRXXp[ST], p[ST]P | |
Rikova K, Hall B (2013) CST Curation Set: 20739, 21166, 30167, 30168, 30169; Year: 2013; Biosample/Treatment: cell line, H2342, H2073, Lou-NH91, HCC15, H1703; Disease: -; TMT: Y; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY, p[ST], RXXp[ST], pSQ, p[ST]QG, LXRXXp[ST], p[ST]P |