|
Powered by Cell Signaling Technology |
Peptide | References | |
---|---|---|
EGMGYGDRTSTFCGTPEFLAPEVLTETSYTR | 1, 4, 5 | View spectrum |
GDRTSTFCGTPEFLAPEVL | 3, 7, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40 | View spectrum |
GDRTSTFCGTPEFLAPEVLTETSY | 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40 | View spectrum |
GMGYGDRTSTFCGTPE | 2, 6, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 | View spectrum |
References | |
---|---|
Moritz A (2007) CST Curation Set: 3608; Year: 2007; Biosample/Treatment: cell line, MKN-45/Su11274; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: MKN-45 (gastric) |
|
Possemato A (2007) CST Curation Set: 3542; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) |
|
Moritz A (2007) CST Curation Set: 3536; Year: 2007; Biosample/Treatment: cell line, NCI-H1703/Gleevec; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: NCI-H1703 (squamous) |
|
Moritz A (2007) CST Curation Set: 3526; Year: 2007; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978 | |
Moritz A (2007) CST Curation Set: 3527; Year: 2007; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: K562 (erythroid) |
|
Moritz A (2007) CST Curation Set: 3449; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) |
|
Moritz A (2007) CST Curation Set: 3366; Year: 2007; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978 | |
Moritz A (2007) CST Curation Set: 3340; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) |
|
Gu T (2007) CST Curation Set: 3330; Year: 2007; Biosample/Treatment: tissue, bone marrow/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978 | |
Rikova K (2007) CST Curation Set: 3287; Year: 2007; Biosample/Treatment: tissue, breast/untreated; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978 | |
Rikova K (2007) CST Curation Set: 3290; Year: 2007; Biosample/Treatment: tissue, breast/untreated; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978 | |
Gu T (2007) CST Curation Set: 3280; Year: 2007; Biosample/Treatment: tissue, blood/untreated; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978 | |
Moritz A (2007) CST Curation Set: 2879; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Moritz A (2007) CST Curation Set: 2880; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Possemato A (2007) CST Curation Set: 2733; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Possemato A (2007) CST Curation Set: 2540; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Moritz A (2007) CST Curation Set: 2541; Year: 2007; Biosample/Treatment: cell line, K562/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: K562 (erythroid) |
|
Possemato A (2007) CST Curation Set: 2495; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Moritz A (2007) CST Curation Set: 2496; Year: 2007; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Moritz A (2006) CST Curation Set: 1965; Year: 2006; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Moritz A (2006) CST Curation Set: 1975; Year: 2006; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate |
|
Goss V (2005) CST Curation Set: 1037; Year: 2005; Biosample/Treatment: blood, B lymphoid/-; Disease: chronic lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: B lymphoid-blood |
|
Goss V (2005) CST Curation Set: 1010; Year: 2005; Biosample/Treatment: blood, B lymphoid/-; Disease: chronic lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: B lymphoid-blood |
|
Goss V (2005) CST Curation Set: 939; Year: 2005; Biosample/Treatment: cell line, CLL23LB4/-; Disease: chronic lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: CLL23LB4 (B lymphocyte) |
|
Goss V (2005) CST Curation Set: 940; Year: 2005; Biosample/Treatment: cell line, M01043/-; Disease: chronic lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: MO1043 (B lymphocyte) |
|
Li Y (2005) CST Curation Set: 902; Year: 2005; Biosample/Treatment: cell line, HCT116/serum starved; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: HCT116 (intestinal) Treatments: serum_starvation |
|
Li Y (2005) CST Curation Set: 904; Year: 2005; Biosample/Treatment: cell line, HCT116/EGF; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: HCT116 (intestinal) Treatments: EGF |
|
Moritz A (2005) CST Curation Set: 790; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 791; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 792; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 793; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 794; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 795; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 796; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 797; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 798; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 799; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 782; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 783; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |
|
Moritz A (2005) CST Curation Set: 707; Year: 2005; Biosample/Treatment: cell line, NCI-H1373/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H1373 (pulmonary) |