Spectra Page

Peptide	References
IGTAEPDYGALYEGRNPGFYVEANPMPTFK	3, 12, 13, 14, 15, 16, 17, 18, 24, 25, 26, 27, 28	View spectrum
NPGFYVEANPMPTFK	1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30	View spectrum

References
1	Rikova K (2007) CST Curation Set: 2869; Year: 2007; Biosample/Treatment: cell line, NCI-H1703/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: NCI-H1703 (squamous) Treatments: serum_starvation
2	Rikova K (2007) CST Curation Set: 2873; Year: 2007; Biosample/Treatment: cell line, HCC827/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: HCC827 (pulmonary) Treatments: serum_starvation
3	Li Y (2007) CST Curation Set: 2488; Year: 2007; Biosample/Treatment: cell line, NCI-H3255/untreated; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: NCI-H3255 (pulmonary)
4	Michaud C (2006) CST Curation Set: 1987; Year: 2006; Biosample/Treatment: cell line, AU565/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: AU565 (breast cell) Treatments: serum_starvation
5	Michaud C (2006) CST Curation Set: 1988; Year: 2006; Biosample/Treatment: cell line, CAL-51/serum starved; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: CAL-51 (breast cell) Treatments: serum_starvation
6	Gu T (2006) CST Curation Set: 1790; Year: 2006; Biosample/Treatment: cell line, SUP-T13/untreated; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: SUP-T13 (T lymphocyte)
7	Gu T (2006) CST Curation Set: 1728; Year: 2006; Biosample/Treatment: cell line, KMS-11/untreated; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: KMS-11 (B lymphocyte)
8	Guo A (2006) CST Curation Set: 1645; Year: 2006; Biosample/Treatment: cell line, KATO III/untreated; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: KATO III (gastric)
9	Gu T (2006) CST Curation Set: 1625; Year: 2006; Biosample/Treatment: cell line, HD-MyZ/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: HD-MyZ (myeloid)
10	Li Y (2006) CST Curation Set: 1264; Year: 2006; Biosample/Treatment: cell line, SW620/untreated; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: SW620 (intestinal)
11	Gu T (2006) CST Curation Set: 1238; Year: 2006; Biosample/Treatment: cell line, RI-1/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: RI-1 (B lymphocyte)
12	Gu T (2006) CST Curation Set: 1174; Year: 2006; Biosample/Treatment: cell line, MO-91/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: MO-91 (myeloid)
13	Gu T (2006) CST Curation Set: 1175; Year: 2006; Biosample/Treatment: cell line, MO-91/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: MO-91 (myeloid)
14	Gu T (2006) CST Curation Set: 1129; Year: 2006; Biosample/Treatment: cell line, DND-41/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: DND-41 (T lymphocyte)
15	Gu T (2006) CST Curation Set: 1130; Year: 2006; Biosample/Treatment: cell line, DND-41/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: DND-41 (T lymphocyte)
16	Gu T (2006) CST Curation Set: 1133; Year: 2006; Biosample/Treatment: cell line, KG-1/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: KG-1 (myeloid)
17	Gu T (2006) CST Curation Set: 1134; Year: 2006; Biosample/Treatment: cell line, KG-1/-; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: KG-1 (myeloid)
18	Stokes M (2006) CST Curation Set: 1072; Year: 2006; Biosample/Treatment: cell line, LN18/serum starved; Disease: glioblastoma multiforme; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: LN18 (glial) Treatments: serum_starvation
19	Spek E (2005) CST Curation Set: 997; Year: 2005; Biosample/Treatment: cell line, Jurkat/calyculin_A & pervanadate; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: calyculin_A, vanadate
20	Stokes M (2005) CST Curation Set: 965; Year: 2005; Biosample/Treatment: cell line, T98G/serum starved; Disease: glioblastoma multiforme; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: T98G (glial) Treatments: serum_starvation
21	Spek E (2005) CST Curation Set: 945; Year: 2005; Biosample/Treatment: cell line, Jurkat/pervanadate &'\|\|' Rapigest lysis; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: vanadate
22	Li Y (2005) CST Curation Set: 834; Year: 2005; Biosample/Treatment: cell line, SW480/serum starved; Disease: colorectal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: SW480 (intestinal) Treatments: serum_starvation
23	Mitchell J (2005) CST Curation Set: 736; Year: 2005; Biosample/Treatment: cell line, MDA-MB453/serum starved; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: MDA-MB-453 (breast cell) Treatments: serum_starvation
24	Gu T (2005) CST Curation Set: 731; Year: 2005; Biosample/Treatment: cell line, SUP-T13/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: SUP-T13 (T lymphocyte)
25	Gu T (2005) CST Curation Set: 732; Year: 2005; Biosample/Treatment: cell line, MOLT-15/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: MOLT-15 (myeloid)
26	Ren H (2005) CST Curation Set: 702; Year: 2005; Biosample/Treatment: cell line, Jurkat/anti-mouse Ig; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: Jurkat (T lymphocyte)
27	Ren H (2005) CST Curation Set: 703; Year: 2005; Biosample/Treatment: cell line, Jurkat/anti-CD3 &'\|\|' anti-mouse Ig &'\|\|' anti-CD28; Disease: T cell leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: Jurkat (T lymphocyte) Treatments: antibody
28	Rikova K (2005) CST Curation Set: 695; Year: 2005; Biosample/Treatment: cell line, NCI-H1703/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: NCI-H1703 (squamous) Treatments: serum_starvation
29	Farnsworth C (2005) CST Curation Set: 574; Year: 2005; Biosample/Treatment: cell line, NCI-H196/EGF; Disease: small-cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: NCI-H196 (pulmonary) Treatments: EGF
30	Rikova K (2004) CST Curation Set: 356; Year: 2004; Biosample/Treatment: cell line, NCI-H1703/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 Cell Line/Tissue: NCI-H1703 (squamous)