Spectra Page

Javascript is not enabled on this browser. This site will not work properly without Javascript.

Home > Spectra Page for site: > Ser912 - AMOTL1 (mouse)

Peptide	References
LFWPSMASLPSRGRLSTAPSNSPILKHPAAKGAVE	1	View spectrum

References
1	Guo A (2007) CST Curation Set: 3219; Year: 2007; Biosample/Treatment: cell line, 3T3-L1/Insulin; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS/T) Immunoaffinity Beads Cat#: 1978 Cell Line/Tissue: 3T3-L1 (fibroblast) Treatments: insulin

References

1

Guo A (2007) CST Curation Set: 3219; Year: 2007; Biosample/Treatment: cell line, 3T3-L1/Insulin; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978
Cell Line/Tissue: 3T3-L1 (fibroblast)
Treatments: insulin

Developed with grants from

and literature mining with Linguamatics

PhosphoSite, created by Cell Signaling Technology is licensed under a Creative Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License.