|
Powered by Cell Signaling Technology |
Peptide | References | |
---|---|---|
EGIGFGDRTSTFCGTPEFLAPEVLTQEAYTR | 1 | View spectrum |
GDRTSTFCGTPEFLAPEVL | 2 | View spectrum |
References | |
---|---|
Moritz A (2007) CST Curation Set: 3526; Year: 2007; Biosample/Treatment: cell line, K562/untreated; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978 | |
Moritz A (2005) CST Curation Set: 796; Year: 2005; Biosample/Treatment: cell line, NCI-H441/-; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: (K/R)XX[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-(Ser/Thr) Akt Substrate Antibody Cat#: 9611
Cell Line/Tissue: NCI-H441 (pulmonary) |