Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus® v6.5.9.3
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Tyr473  - CENTD1 (human)

PeptideReferences 
HSYPLSSTSGNADSSAVSSQAISPYACFYGASAK 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 View spectrum

References 

1

Ren H (2007) CST Curation Set: 3473; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991

2

Ren H (2007) CST Curation Set: 3443; Year: 2007; Biosample/Treatment: tissue, ovary/untreated; Disease: ovarian cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: ovary

3

Rikova K (2007) CST Curation Set: 2873; Year: 2007; Biosample/Treatment: cell line, HCC827/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC827 (pulmonary)
Treatments:  serum_starvation

4

Rikova K (2007) CST Curation Set: 2874; Year: 2007; Biosample/Treatment: cell line, HCC827/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC827 (pulmonary)
Treatments:  serum_starvation

5

Rikova K (2007) CST Curation Set: 2875; Year: 2007; Biosample/Treatment: cell line, HCC827/serum starved; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC827 (pulmonary)
Treatments:  serum_starvation

6

Michaud C (2006) CST Curation Set: 2107; Year: 2006; Biosample/Treatment: cell line, HCC1599/0.5% serum; Disease: breast cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: HCC1599 (breast cell)
Treatments:  serum_starvation

7

Rikova K (2006) CST Curation Set: 2103; Year: 2006; Biosample/Treatment: cell line, SW780/serum starved; Disease: bladder cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SW780 (bladder cell)
Treatments:  serum_starvation

8

Guo A (2006) CST Curation Set: 1929; Year: 2006; Biosample/Treatment: cell line, SNU-5/-; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SNU-5 (gastric)

9

Gu T (2006) CST Curation Set: 1875; Year: 2006; Biosample/Treatment: cell line, CMS/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CMS (myeloid)

10

Moritz A (2006) CST Curation Set: 1822; Year: 2006; Biosample/Treatment: cell line, SEM/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SEM (B lymphocyte)

11

Michaud C (2006) CST Curation Set: 1814; Year: 2006; Biosample/Treatment: cell line, DU4475/serum starved; Disease: breast adenocarcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: DU4475 (breast cell)
Treatments:  serum_starvation

12

Guo A (2006) CST Curation Set: 1720; Year: 2006; Biosample/Treatment: cell line, PC9/untreated; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: PC9 (pulmonary)

13

Gu T (2006) CST Curation Set: 1626; Year: 2006; Biosample/Treatment: cell line, L428/untreated; Disease: Hodgkin's lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: L428 (lymphoid)

14

Gu T (2006) CST Curation Set: 1415; Year: 2006; Biosample/Treatment: cell line, SEM/untreated; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SEM (B lymphocyte)

15

Yu J (2006) CST Curation Set: 1395; Year: 2006; Biosample/Treatment: cell line, Kyse510/-; Disease: esophageal carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: Kyse510 (esophageal)

16

Gu T (2006) CST Curation Set: 1238; Year: 2006; Biosample/Treatment: cell line, RI-1/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: RI-1 (B lymphocyte)

17

Gu T (2006) CST Curation Set: 1219; Year: 2006; Biosample/Treatment: cell line, CI-1/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CI-1 (B lymphocyte)

18

Gu T (2006) CST Curation Set: 1221; Year: 2006; Biosample/Treatment: cell line, RC-K8/-; Disease: B cell lymphoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: RC-K8 (B lymphocyte)

19

Goss V (2005) CST Curation Set: 673; Year: 2005; Biosample/Treatment: cell line, SD1/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SD1 (lymphoblastoid)

20

Goss V (2005) CST Curation Set: 666; Year: 2005; Biosample/Treatment: cell line, BV-173/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BV-173 (myeloid)

21

Gu T (2005) CST Curation Set: 628; Year: 2005; Biosample/Treatment: cell line, SEM/-; Disease: acute lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: SEM (B lymphocyte)

22

Goss V (2004) CST Curation Set: 277; Year: 2004; Biosample/Treatment: cell line, CLL23LB4/-; Disease: chronic lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: CLL23LB4 (B lymphocyte)

23

Goss V (2004) CST Curation Set: 290; Year: 2004; Biosample/Treatment: cell line, MEC1/-; Disease: chronic lymphocytic leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: MEC1 (B lymphocyte)