|
Powered by Cell Signaling Technology |
Peptide | References | |
---|---|---|
SPPSAGSHQGPVIYAQLDHSGGHHSGK | 1, 2, 3, 4 | View spectrum |
SPPSAGSHQGPVIYAQLDHSGGHHSGKINK | 2 | View spectrum |
References | |
---|---|
Gu T (2007) CST Curation Set: 3408; Year: 2007; Biosample/Treatment: cell line, Baf3(PLXSN-NEO-FLT3 (D835Y))/IL3 withdrawal; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor') Treatments: IL-3_withdrawal |
|
Gu T (2007) CST Curation Set: 3409; Year: 2007; Biosample/Treatment: cell line, Baf3(PLXSN-NEO-FLT3 (D835Y))/IL3 withdrawal; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor') Treatments: IL-3_withdrawal |
|
Guo A (2007) CST Curation Set: 2672; Year: 2007; Biosample/Treatment: tissue, brain/-; Disease: -; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Goss V (2006) CST Curation Set: 1403; Year: 2006; Biosample/Treatment: cell line, BaF3/-; Disease: chronic myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991
Cell Line/Tissue: BaF3 ('B lymphocyte, precursor') |