Spectra Page
Javascript is not enabled on this browser. This site will not work properly without Javascript.
PhosphoSitePlus Homepage PhosphoSitePlus® v6.5.9.3
Powered by Cell Signaling Technology
Home > Spectra Page for site: > Ser448  - MYST3 (human)

PeptideReferences 
QYRIRKRGNRKSSTSDWPTDNQDGWDGKQE 1, 2, 3 View spectrum

References 

1

Gu T (2007) CST Curation Set: 3330; Year: 2007; Biosample/Treatment: tissue, bone marrow/untreated; Disease: acute myelogenous leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978

2

Gu T (2007) CST Curation Set: 3280; Year: 2007; Biosample/Treatment: tissue, blood/untreated; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978

3

Gu T (2007) CST Curation Set: 3283; Year: 2007; Biosample/Treatment: tissue, blood/untreated; Disease: leukemia; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: RXXp[ST] Antibodies Used to Purify Peptides prior to LCMS: Phospho-Akt Substrate (RXRXXS/T) (110B7) Rabbit mAb Cat#: 9614, PTMScan(R) Phospho-Akt Substrate Motif (RXXS*/T*) Immunoaffinity Beads Cat#: 1978