|
Powered by Cell Signaling Technology |
Peptide | References | |
---|---|---|
STTSHISKRPVFLSEETPYSYPTGNHTYQE | 1, 2 | View spectrum |
References | |
---|---|
Guo A (2007) CST Curation Set: 2781; Year: 2007; Biosample/Treatment: cell line, MKN-45/-; Disease: gastric carcinoma; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 | |
Moritz A (2007) CST Curation Set: 2777; Year: 2007; Biosample/Treatment: cell line, NCI-H3255/Iressa; Disease: non-small cell lung cancer; SILAC: -; Specificities of Antibodies Used to Purify Peptides prior to LCMS: pY Antibodies Used to Purify Peptides prior to LCMS: Phospho-Tyrosine Mouse mAb (P-Tyr-100) Cat#: 9411, PTMScan(R) Phospho-Tyr Motif (Y*) Immunoaffinity Beads Cat#: 1991 |