Multiple Sequence Alignment:
SLMO1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |  
SLMO1 human MKIWSSEHVFGHPWDTVIQAAMRKYPNPMNPSVLGVDVLQRRVDGRGRLHSLRLLSTEWGLPSLVRAILGTSRTLTYIREHSVVDPVEKKMELCSTNITLTNLVSVNERLVYTPHPENPEMTVLTQEAIITVKGISLGSYLESLMANTISSNAKKGWAAIEWIIEHSESAVS
SLMO1 mouse MKIWSSEHVFGHPWDTVIKAAMRKYPNPMNPCVVGVDVLERSVDGCGRLHSLRLLSTEWGLPGLVRAILGANRTLTYIKERSVVDPAARKMELCSTNITLTNLVSVNERLVYTPHPENPEKTVLTQEAIITVKGISLGSYLESLMATTISSNAKKGWAAIEWIIEHSESAIS
  ******************:************:*:*****:*:***:****************:*******::******:*:*****:::*******************************:*************************:***********************:*
Consensus MKIWSSEHVFGHPWDTVIQAAMRKYPNPMNPCVLGVDVLQRRVDGRGRLHSLRLLSTEWGLPGLVRAILGANRTLTYIRERSVVDPAARKMELCSTNITLTNLVSVNERLVYTPHPENPEKTVLTQEAIITVKGISLGSYLESLMANTISSNAKKGWAAIEWIIEHSESAIS
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.