Multiple Sequence Alignment:
GCSH Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170   )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |   
GCSH human MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRtGPALLsVRKFTEKHEWVtTENGIGTVGISNFAQEALGDVVYCsLPEVGTKLNKQDEFGALESVKAASELYSPLsGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMsEEAyEkYIKSIEE
GCSH mouse MSLQVSRSLRVVAYSLRTA---LAFCSPRPCVPSAAAVRSLRTGSALLsVRKFTEKHEWITTEEGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMsEEAYEkYVKSIEE
GCSH rat MSLRVVRSVRAVACSLRIA---LASCPPRPWAPSAAAVRSLRTGSALLSVRkFTEkHEWVTAKDGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMsEEAYEkYVKSIEE
  *:*:*:**:*:::::**::...:*.*:***::::::***:****:**************:*::.******************************:**:************************:***************************:****************:*****
Consensus MSLRVVRSVRAVACSLRAA---LAFCPPRPWAPSAAAVRSLRTGSALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMSEEAYEKYVKSIEE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.