Multiple Sequence Alignment:
APOC1 Download MSA
  (        10        20        30        40        50        60        70        80        )
           |         |         |         |         |         |         |         |        
APOC1 human MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSAL----DKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS-
APOC1 mouse MRLFIALPVLIVVVAMTLEGPAPAQAAPDLSGTLESIPDKLkEFGNTLEDkARAAIEHIkQKEILTKTRAWFSEAFGkVKEKLKTTFS
APOC1 rat MRLFIALPVLIVVVAMALEGPAPAQAAPDFSSAMESLPDKLKEFGNTLEDkARAAIEHIKQkEIMIkTRNWFSETLNKMKEKLKTTFA
  ****::****:**::::********::**.*:::::.:***************::*::***:*:.:*:*:****::.*:*****:::.
Consensus MRLFIALPVLIVVVAMALEGPAPAQAAPDLSSALESIPDKLKEFGNTLEDKARAAIEHIKQKEILAKTRAWFSETFNKVKEKLKTTFA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.