Multiple Sequence Alignment:
TRAPPC2L Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |
TRAPPC2L human MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGkALVDQRELYLGLLYPTEDYKVyGYVTNSkVKFVMVVDSSNTALRDNEIRSMFRkLHNsyTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC
TRAPPC2L mouse MAVCIAVIAKENYPLYIRSTPTESELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDsSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQ-SRAFDTMVTSMMIQVC
TRAPPC2L rat
  ***********************:***************************************************************************************************.*****:**********
Consensus MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.