Multiple Sequence Alignment:
ABHD17A Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |
ABHD17A human MNGLsLsELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGAAPLGtLRASSGAPGRWkLHLTERADFQYSQRELDTIEVFPTkSARGNRVSCMYVRCVPGARYTVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTkkTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPsQRA
ABHD17A iso2 human
ABHD17A mouse MNGLSVSELCCLFCCPPCPGRIAAKLAFLPPDPTYSLVPEPEPGPGGAGAAPSGPLRTSAATPGRWKIHLTERADFQYGQRELDTIEVFVTkSARANRIACMYVRCVPGARYTVLFSHGNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTkKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPSQRA
ABHD17A rat MNGLSVSELCCLFCCPPCPGRIAAKLAFLPPEPTYSLVPEPEPGPGGAGAAPSGPLRTSAATPGRWKIHLTERADFQYGQRELDTIEVFVTKSARANRIACMYVRCVPGARYTVLFSHGNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPSQRT
  *****:*************************::*******************:*:**:*:::*****:**********:**********:*****:**::***************************:***:***:*::************:*******:*****************************************************************************************************************************************************:
Consensus MNGLSVSELCCLFCCPPCPGRIAAKLAFLPPEPTYSLVPEPEPGPGGAGAAPSGPLRTSAATPGRWKIHLTERADFQYGQRELDTIEVFVTKSARANRIACMYVRCVPGARYTVLFSHGNAVDLGQMCSFYVGLGTRIGCNIFSYDYSGYGISSGRPSEKNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPSQRA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.