Multiple Sequence Alignment:
COX17 Download MSA
  (        10        20        30        40        50        60   )
           |         |         |         |         |         |   
COX17 human MpGLVDsNPAPPEsQEkkPLkPCCACPETkkARDACIIEKGEEHCGHLIEAHKECMRALGFkI
COX17 mouse MPGLAAASPAPPEAQEKKPLKPCCACPETkkARDACIIEKGEEHCGHLIEAHKECMRALGFkI
  ****::::*****:*************************************************
Consensus MPGLAAANPAPPEAQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.