Multiple Sequence Alignment:
COX6B1 Download MSA
  (        10        20        30        40        50        60        70        80      )
           |         |         |         |         |         |         |         |      
COX6B1 human MAEDMETkIKNYkTAPFDSRFPNQNQTRNCWQNyLDFHRCQkAMtAkGGDIsVCEWYQRVYQSLCPTSWVTDWDEQRAEGtFPGkI
COX6B1 mouse MAEDIKTKIKNYkTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVsVCEWYRRVYKSLCPVSWVsAWDDRIAEGTFPGkI
COX6B1 cow MAEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
  ****:.:*****:**************:************:*********:******:***:****.***::**:::*********
Consensus MAEDIQTKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSAWDDRRAEGTFPGKI
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.