Multiple Sequence Alignment:
APC13 Download MSA
  (        10        20        30        40        50        60        70    )
           |         |         |         |         |         |         |    
APC13 human
APC13 mouse
  *********************************:*****************************:*******:**
Consensus MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQGLHENVPPAGN
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.