Multiple Sequence Alignment:
COX6C Download MSA
  (        10        20        30        40        50        60        70      )
           |         |         |         |         |         |         |      
COX6C human MAP-EVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKkAyADFyRNYDVMkDFEEMRkAGIFQsVk
COX6C mouse MssGALLPkPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMkDFEEMRkAGIFQSAk
COX6C rat MsSGALLPkPQMRGLLAkRLRVHIVGAFVVALGVAAAYKFGVAEPRKkAYADFYRNYDSMkDFEEMRQAGVFQsAK
COX6C cow MST--ALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK
  *:...:*:**:******:***.*:::**:::**:*::***:**:.******:******:********:**:***:*
Consensus MSSGALLPKPQMRGLLARRLRVHIAGAFVVALGVAAAYKFGVAEPRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.