Multiple Sequence Alignment:
UBE2L6 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150   )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |   
UBE2L6 human MMASMRVVkELEDLQKkPPPYLRNLsSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWkPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRkNAEEFTLRFGVDRPs
UBE2L6 mouse MMASKRVAkELESLSkELPPYLRQLSSDDANVLVWHMLLLPDQLPYGLKAFQVRIDFPREYPFkPPTLRFTTkIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKkAEEFTLkFGVDRPS
  ****:**:****:*:*::*****:************:******:**:****::**:**:*******:::**********:*:*::***:**:*****:**::**********::**::**:*::**********:***:******:*******
Consensus MMASKRVAKELEDLQKELPPYLRNLSSDDANVLVWHALLLPDQLPYGLKAFNLRIDFPREYPFKPPMIRFTTKIYHPNVRENGQICLPIISNENWKPCTKPCQVLEALNVLVNRPNIREPLRLDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.