Multiple Sequence Alignment:
PQBP1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270     )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |     
PQBP1 human ----MPLPVALQTrLAKRGILkHLEPEPEEEIIAEDyDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLsPHDPNSVVTKSAKKLRssNADAEEKLDRSHDKsDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGyDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPyPKSkKAVSRKDE------ELDPMDPSSysDAPrGTWStGLPKRNEAKTGADTTAAGPLFQQRPYPsPGAVLRANAEASRTKQQD
PQBP1 iso3 human ----MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDyDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKGKLGRMGLGETNKVQGALREEAFPQ--KDAWTWG---------------------------------------------
PQBP1 iso11 human MLsAMPLPVALQtRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGCAPGQCRGLPNQ---AAGLKL---------------------------------------------------------------------------------------------------------------------------
PQBP1 mouse ----MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRIEGLPPSWYKVFDPSCGLPYYWNVETDLVSWLSPHDPNFVVTKSAKKVRNNNADAEDKSDRNLEKVDRNHEKSDRSHEKPDRSHEKADRNHEKNDRERERNYDKVDRERDRDR--ERERAFDKADREEGKDRRHHRREELAPYPKNKKATSRKDE------ELDPMDPSSYSDAPRGtWSTGLPKRNEAKTGADTTAAGPLFQQRPYPsPGAVLRANAEASRTKQQD
PQBP1 rat ----MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRIEGLPPSWYKVFDPSCGLPYYWNVETDLVSWLSPHDPNFVVSKSAKKLRNSNADAEDKSERNLEKVDRNHEKSDRSHEKPDRSHEKADRNHEKSDRERERNYDkVDRERDRDR--ERERAFDkADREDGKDRRHHRREELAPYPKNKKATSRKDE------ELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRSKQQD
      ********************************************:**********************::*************:**:*****:*::*****:*::*:::*:**:*:********:**:::::::.:.::::.::::::::::::.:::...:.::.::::::.::.::::::::::::::.:::......      ...:....:.......::..:.............................................
Consensus ----MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKADRNHDKSDRDRERGYDKVDRERDRDR--DRDRAFDKADREEGKDRRHHRREELAPYPKNKKATSRKDE------ELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.