Multiple Sequence Alignment:
SUMO1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100 )
           |         |         |         |         |         |         |         |         |         | 
SUMO1 human MsDQEAkPstEDLGDkkEGEYIkLkVIGQDSsEIHFkVkMTTHLkkLkESYCQRQGVPMNSLrFLFEGQrIADNHtPkELGMEEEDVIEVYQEQTGGHSTV
SUMO1 iso2 human -------------------------MsDQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
SUMO1 mouse MsDQEAKPsTEDLGDKKEGEYIKLKVIGQDSsEIHFkVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHtPkELGMEEEDVIEVYQEQTGGHSTV
SUMO1 rat MsDQEAkPSTEDLGDKKEGEYIkLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
  ::::::::::::::::::::::::::::*************************************************************************
Consensus MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.