Multiple Sequence Alignment:
H1T Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210 )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         | 
H1T human MSETVPAASASAGVAAMEKLPtKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKkALAAAGyDVEkNNsRIKLSLKSLVNKGILVQTRGtGAsGsFkLSkKVIPKSTRSKAKKSVSAKTKKLVLSRDsKsPKTAKtNKRAKKPRAttPkTVRSGRKAkGAKGKQQQKSPVKARASKSKLTQHHEV----NVRKATSKK
H1T mouse MSETAPAAsSTLVPAPVEKPSSKRRGKKPG--LAPARKPRGFSVSKLIPEALSTSQERAGMSLAALKkALAAAGYDVEkNNSRIKLALKRLVNKGVLVQtKGtGAsGsFKLSkKAASGNDKGKGKKSAsAKAKKMGLPRASRsPKSSKT-KAVKKPKAtPTKASGSGRKtKGAKGVQQRKsPAKARAANPNSGKAKMVMQKTDLRKAAGRK
H1T rat MsETAPAAsSTLVPAPVEKPATKRRGKkPG--MATARKPRGFSVSKLIPEALSMSQERAGMSLAALKKALAAAGYDVEkNNSRIKLALKRLVNkGVLVQTKGTGASGSFKLSKKAASGNDKGKGKKSASAKAKKLGLSRASRsPKSSKT-KVVKKPKAtPTKGSGSRRKTKGAKGLQQRKsPAKARATNsNSGKSKMVMQkTDLRKAAGRK
  ****:****:::::*::**:::*:**:**:...:::**::::******:****.****:****:**********************:**:*****:****:*************::::::::*:***:***:**::*:*:*:***::**.*::***:**::*:::*:**:*****.**:***:****::::::::::*::::::***:::*
Consensus MSETAPAASSTLVPAPVEKPATKRRGKKPG--IAAARKPRGFSVSKLIPEALSMSQERAGMSLAALKKALAAAGYDVEKNNSRIKLALKRLVNKGVLVQTKGTGASGSFKLSKKAASGNDKGKGKKSASAKAKKLGLSRASRSPKSSKT-KAVKKPKATPTKASGSGRKTKGAKGLQQRKSPAKARAANSNSGKAKMVMQKTDLRKAAGRK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.