Multiple Sequence Alignment:
snRNP G Download MSA
  (        10        20        30        40        50        60        70      )
           |         |         |         |         |         |         |      
snRNP G human MSkAHPPELkkFMDkkLSLkLNGGRHVQGILRGFDPFMNLVIDECVEMAtSGQQNNIGMVVIRGNsIIMLEALErV
snRNP G mouse MSKAHPPELkKFMDKKLSLkLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNsIIMLEALERV
snRNP G rat
  ****************************************************************************
Consensus MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.