Multiple Sequence Alignment:
SAP30BP Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
SAP30BP human MAGKKNVLssLAVyAEDsEPEsDGEAGIEAVGSAAEEKGGLVsDAyGEDDFsRLGGDEDGyEEEEDENsRQsEDDDsEtEKPEADDPKDNTEAEKRDPQELVAsFsERVRNMsPDEIKIPPEPPGRCSNHLQDkIQkLYERKIkEGMDMNyIIQRKkEFRNPsIyEkLIQFCAIDELGTNYPKDMFDPHGWSEDSyYEALAkAQKIEMDkLEKAKKERTkIEFVTGTkKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGtIVkKAKQ
SAP30BP iso2 human MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQS----------------DNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ
SAP30BP mouse MAGKKNVLSSLAIYAEYsDPEsDGEtGVDAVGGATEEKGGLVsDAYGEDDFsRPGGDEDGYEEEEDENSKQSEDDDsEtEKPEADDPKDNTEAEKRDPQELVASFSERVRNMsPDEIKIPPEPPGRCSNHLQDKIQKLYERKIkEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGtttNATATsTSTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ
SAP30BP rat MAGKKNVLSSLAVYAEYSDPEsDGETGVDAVGSAAEEKGGLVSDAYGEDDFSRPGGDEDGYEEEEDENSKQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSEKVRNMsPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDkLEKAKKERTKIEFVTGTKKGTTTNATATTTSTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ
  ************:***:*:******:*::***:*:******************:***************:**::::::::::::::::*******************:********************************************************************************************************************************:*:*:*******************************************************************
Consensus MAGKKNVLSSLAVYAEDSDPESDGEAGIDAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATATTTSTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.