Multiple Sequence Alignment:
RAB1B Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200 )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         | 
RAB1B human MNPEyDyLFKLLLIGDsGVGKSCLLLRFADDTyTEsyISTIGVDFKIRtIELDGkTIkLQIWDtAGQERFRtItSSyyRGAHGIIVVYDVtDQESyANVkQWLQEIDrYAsENVNkLLVGNkSDLTTKKVVDNTTAKEFADsLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAAsGGERPNLKIDStPVKPAGGGCC
RAB1B mouse MNPEyDyLFKLLLIGDsGVGKSCLLLRFADDTYTESyISTIGVDFKIRTIELDGkTIkLQIWDTAGQERFRtITsSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRyAsENVNkLLVGNKSDLTTKKVVDNTTAkEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAAsGGERPNLKIDSTPVKPASGGCC
RAB1B rat MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGkTIkLQIWDTAGQERFRTVTSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKSASGGCC
  ************************************************************************:***********************************************************************:*************************************************:*:****
Consensus MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.