Multiple Sequence Alignment:
SFRS3 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160    )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |    
SFRS3 human MHRDsCPLDCkVyVGNLGNNGNktELErAFGyyGPLrSVWVARNPPGFAFVEFEDPrDAADAVRELDGRtLCGCRVRVELsNGEkRSRNrGPPPsWGrRPRDDYRRRsPPPRRRSPRRRsFsRsRsRsLsRDRRRERsLsRERNHKPsRsFsRsRSRSRSNERK
SFRS3 mouse MHRDsCPLDCkVYVGNLGNNGNkTELERAFGyYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEkRsRNRGPPPsWGRRPRDDYRRRsPPPRRRSPRRRsFsRsRsRsLsRDRRRERsLsRERNHKPsRsFsRsRSRSRSNERK
SFRS3 rat MHRDSCPLDCKVYVGNLGNNGNkTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEkRSRNRGPPPSWGRRPRDDYRRRsPPPRRRSPRRRSFSRSRsRsLsRDRRRERSLsRERNHKPsRsFsRSRSRSRSNERK
  ********************************************************************************************************************************************************************
Consensus MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.