Multiple Sequence Alignment: | |
RAB1A | Download MSA |
( 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 ) | |
---|---|
| | | | | | | | | | | | | | | | | | | | | |
RAB1A human | |
RAB1A mouse | |
RAB1A rat | |
************************************************************************************************************************************************************************************************************* | |
Consensus | MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC |
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers. |
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT. |