Multiple Sequence Alignment:
RRas2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200    )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |    
RRas2 human MAAAGWRDGsGQEKyRLVVVGGGGVGKSALTIQFIQSYFVTDyDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIyKFQRQILRVKDRDEFPMILIGNkADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRkFQEQECPPsPEPtRkEKDKKGCHCVIF
RRas2 mouse MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIykFQRQILRVKDRDEFPMILIGNkADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRkFQEQECPPsPEPtRKEkDkKGCHCVIF
RRas2 rat MAAAGWRDGSGQEkYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYkFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPsPEPTRKEKDKKGCHCVIF
RRas2 cow MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPsPEPTRKEKDKKGCHCVIF
  ************************************************************************************************************************************************************************************************************
Consensus MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.