Multiple Sequence Alignment:
CCL28 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130)
           |         |         |         |         |         |         |         |         |         |         |         |         |
CCL28 human MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKkNGkGNVCHRKKHHGKRNSNRAHQGKHETYG---HKTPY
CCL28 mouse MQQAGLTLMAVAVCVAFQTSEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
  ***:**:::*:***:*:::******:***********:*:******::*:***********************:****:*:****:::::****::***::**:::::::::::::**:*:*...*::::
Consensus MQQAGLAIMALAVCAALQASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRAQAAKKNGRENVCHRKKQHGRRNRNRAHQRKHRTRGTHRHEAPR
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.