Multiple Sequence Alignment:
CSTB Download MSA
  (        10        20        30        40        50        60        70        80        90        )
           |         |         |         |         |         |         |         |         |        
CSTB human MMCGAPsAtQPATAETQHIADQVRSQLEEKENKKFPVFkAVSFksQVVAGtNyFIKVHVGDEDFVHLrVFQsLPHENkPLTLsNYQTNKAkHDELtyF
CSTB mouse MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFkAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENkPLTLSSYQTNKERHDELSyF
CSTB rat
  *********:*******::****:****:***:**:****:***:*:*****:****:**::::*******:***********:*****::****:**
Consensus MMCGAPSATQPATAETQEIADQVRSQLEEKENQKFDVFKAISFKRQIVAGTNLFIKVDVGDDDCVHLRVFQPLPHENKPLTLSNYQTNKARHDELSYF
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.