Multiple Sequence Alignment:
RPLP2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110     )
           |         |         |         |         |         |         |         |         |         |         |     
RPLP2 human MRyVAsyLLAALGGNssPsAkDIkkILDsVGIEADDDRLNkVISELNGkNIEDVIAQGIGkLAsVPAGGAVAVsAAPGsAAPAAGsAPAAAEEkkDEkKEEsEEsDDDMGFGLFD
RPLP2 mouse MRyVAsyLLAALGGNssPsAkDIkkILDSVGIEADDDRLNkVISELNGkNIEDVIAQGVGkLAsVPAGGAVAVsAAPGsAAPAAGsAPAAAEEKKDEkKEEsEEsDDDMGFGLFD
RPLP2 rat MRYVASYLLAALGGNSNPSAkDIKkILDSVGIEADDERLNkVISELNGkNIEDVIAQGVGkLASVPAGGAVAVSAAPGsAAPAAGsAPAAAEEKKDEKKEEsEEsDDDMGFGLFD
  ****************:*******************:*********************:********************************************************
Consensus MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.