Multiple Sequence Alignment:
p15-INK4B Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130        )
           |         |         |         |         |         |         |         |         |         |         |         |         |        
p15-INK4B human MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHrAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
p15-INK4B mouse ML--------GGSSDAGLAtAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD
  *:........**:**:***:*****:**:************::******:*********:************************************************:*************:****:*:**::****
Consensus MREENKGMPSGGGSDAGLASAAARGQVEKVRQLLEAGADPNALNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDIARYLRAATGD
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.