Multiple Sequence Alignment:
C1orf52 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180  )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |  
C1orf52 human MAAEEKDPLSYFAAYGSSSSGSSDEEDNIEPEETSRRTPDPAKSAGGCRNKAEKRLPGPDELFRsVtRPAFLyNPLNkQIDWERHVVKAPEEPPKEFKIWksNyVPPPETYTtEKKPPPPELDMAIKWsNIyEDNGDDAPQNAkKARLLPEGEEtLEsDDEKDEHTSKKRKVEPGEPAkKKK
C1orf52 mouse MAAEEKDPLSYFAAYGSSSSDSSDE--NSEPEDAGRKEAASAPTTGGrGKQAEKRLPGPDELFRSVTRPAFLYNPLNKQIDWERHVVKAPEEPPKEFKIWKSNCVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEEtVEsDDDKDERASKIRRVEPGEAAKKKK
C1orf52 rat MAAEEKDPLSYFAAYGSSSSDSSDEE-NSEPEDAGRKEAAPAPTTGGRGKQAEKRLPGPDELFRSVTRPAFLY-------------------PPKEFKIWKSNCVPPPETYTAEKkPPPPELDMAIKWSNIYEDNGDDAPQNAkKARLLPEGEETVEsDDDRDERASKTRRVEPGEAAkKKK
  ********************:****:.*:***:::*:::::*:::**::::**********************:::::::::::::::::::***********:********:******************************************:****::**::**.*:*****:*****
Consensus MAAEEKDPLSYFAAYGSSSSDSSDEE-NSEPEDAGRKEAAPAPTTGGRGKQAEKRLPGPDELFRSVTRPAFLYNPLNKQIDWERHVVKAPEEPPKEFKIWKSNCVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETVESDDDKDERASKIRRVEPGEAAKKKK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.