Multiple Sequence Alignment:
NSUN5 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470  )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |  
NSUN5 human MGLYAAAAGVLAGVESRQGSIkGLVYSSNFQNVkQLyALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVyELLLGkGFrGGGGRWkALLGRHQARLkAELARLKVHRGVsRNEDLLEVGSRPGPASQLPRFVRVNTLkTCSDDVVDYFkRQGFSYQGRASsLDDLRALKGkHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLkNQGkIFAFDLDAkRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGtPsPVRLHALAGFQQrALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRAsPETTLSSGFFVAVIERVE-VPR------------------------------------------
NSUN5 iso2 human MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVE-VPSSAsQAkAsAPERtPsPAPKRKKRQQRA-----AAGACtPPCt
NSUN5 iso4 human MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVE-VPSLTGQSISTRTHTQPSPKEKEETAKSRSRCLHTALHIAEAPG-
NSUN5 mouse MGLYAAAAAVLAGVESRQGSLKGLVYSSNFQNLKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLQESSRPGQAYQVPRFVRVNTLKTRPEDAIDYFKRQGFSYQGRASsLEDLRALKGQHFLLDPLLPELLVFPAQTDLHEHPLYRAGHLILQDKASCLPAMLLSPPPGsHVIDACAAPGNKTsYIAALLKNQGKIFAFDQDAKRLAAMATLVARAGVSCCELAEKDFLTVSPSDQRYSQVQYILLDPsCsGsGMLSRQLEEHGEGTPSKERLQALAGFQQRALCHALRFPSLQRLVYSTCSLCQEENEDVVQEALQHNSGTFRLAPVLPTWPHRGLSTFPGSEHCLRASPETTLTGGFFIAVFERAEVVPTPAPQTDA----MDPEPLSQVPKRKRRRK---AAVGASMQPST
NSUN5 rat MGLYATAAAVLAGVESRQGSLKGLVYSSNFQNLKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLQE--RPGQAHQVPRFVRVNTLKTCPEDAIDYFKRQGFSYQGRASSLEDLRTLKGQHFLLDPLLPELLVFPAQTDLHEHPLYRAGHLILQDKASCLPAMLLSPPPGSHVIDACAAPGNKTSYIAALLKNQGKIFAFDQDAKRLAAMATLLARAGVSCCEVAEKDFLTVSPSDQRYGQVQYILLDPSCSGSGMLSRQLEEHGEGTPSKERLQALAGFQQRALCHALRFPSLQRLVYSTCSLCQEENEDVVQEALQQNSGTFRLAPVLPTWPHRGLSTFPGSEHCLRASPETTLTGGFFIAVFERAEVVPSPAPQTSA----VVPEPLSKAPKRKRRR---------------
  *****:**:***********:***********:*****************************************************************************************::.:***:*:*:***********:::*::*****************:***:***:*******:***************************:*********:*******************::**************:******:****:*********:**:***:*****:**::*:*************:******:*:****::**:**************:***********************::***:*:*:*****:**:***********:************::***:**:**:*.**:.:.:..: .  ..:.:......:..:.    ...........
Consensus MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVE-VPSPAPQTDA----RDPEPLSKAPKRKRRR-----A-GA---P--
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.