Multiple Sequence Alignment:
SRSF10 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260   )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |   
SRSF10 human MsRyLrPPNtSLFVrNVADDtrsEDLRREFGRYGPIVDVyVPLDFYTRRPRGFAyVQFEDVrDAEDALHNLDRKWICGRQIEIQFAQGDRktPNQMKAkEGRNVysssRyDDyDRYRRsRsRsYERRRsRsRsFDyNyRRSysPRNsRPtGRPRRsRsHsDNDRFKHRNRs-FsRsKSNSRSRSKSQPKKEMKAKSRSRsAsHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRsKSQSRSQSRSRSKsRsRsWtsPKssGH
SRSF10 iso2 human MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRN-RPTGRPRRSRSHSDNDRFKHRNRS-FSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH
SRSF10 iso3 human MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRsRsHsDNDRPNCsWNtQYSSAYYTSRKI--------------------------------------------------------------------------------
SRSF10 iso4 human MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRsRsHsDNDSQVSKKKN-ER-----------------------------------------------------------------------------------------
SRSF10 iso5 human MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPR------------------KPNCSWNtQYSSAYYTSRKI--------------------------------------------------------------------------------
SRSF10 mouse MSRYLRPPNTSLFVRNVADDTRsEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKtPNQMKAKEGRNVYsSSRYDDYDRYRRsRsRsYERRRsRsRsFDyNyRRsYsPRNSRPTGRPRRsRsHsDNDRFKHRNRS-FSRsKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTsKTDSKTHYKSGSRYEKESRKKEPPRsKSQSRSQSRSRSKsRsRsWTsPKsSGH
SRSF10 iso2 mouse MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRsRsHsDNDRPNCsWNtQYSSAYYTSRKI--------------------------------------------------------------------------------
SRSF10 rat MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRsRsRSYERRRsRsRsFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDR---------------------------------------------------------------------------------------------------
  *************************************************************************************************************************************************:::::::::::::::::::.........:.:...::..................................................................................
Consensus MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFNCRNRS-FSRAKSNSRKR--------------------------------------------------------------------------------
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.