Multiple Sequence Alignment:
S100A16 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120    )
           |         |         |         |         |         |         |         |         |         |         |         |    
S100A16 human MsDCYTELEKAVIVLVENFyKYVSkysLVkNKISkSSFREMLQKELNHMLsDTGNRkAADkLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQsss---------------------
S100A16 mouse MADCYTELEKAVVVLVENFYKYVsKHsLVKNKISKSSFRKMLQRELNHMLTDTGNRKAADKLIQNLDANHDGRICFDEYWTMIGGITSPMANLIRQQECQQESQQECQQESQQESQQESQQGSS
  *:**********:************:*************:***:******:***********************:******:*****:*:*:**::**:*::*.....................
Consensus MADCYTELEKAVIVLVENFYKYVSKHSLVKNKISKSSFREMLQRELNHMLSDTGNRKAADKLIQNLDANHDGRICFDEYWTLIGGITGPIANLIRQQECQQESQQECQQESQQESQQESQQGSS
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.