Multiple Sequence Alignment:
CDO1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200)
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |
CDO1 human MEQtEVLkPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYtRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNAtsGSLENN
CDO1 mouse MERTELLkPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLkETLFDWPDkKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTsGsLENN
  **:**:**************:**************::*****:*:***:****************************************:******:**********:*********:*****:********************:*********************************************::********
Consensus MERTELLKPRTLADLIRILHQLFAGDEVNVEEVQAILEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKLLQGNLKETLFAWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.