Multiple Sequence Alignment:
MTAP Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |       
MTAP human MAsGttttAVKIGIIGGTGLDDPEILEGRTEkYVDTPFGkPSDALILGkIKNVDCVLLArHGRQHTIMPSkVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAkKLGLRCHSkGTMVTIEGPRFSSRAEsFMFRtWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDrVLKTLKENANKAkSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLL--------------------------------------------PR--------------------H
MTAP iso2 human MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLK-MIKFQMILSEGYHPFNIQESPFYRGLLDFPSVGHGRGKKCLSAPAIILRPPQPRGTVTTFKVSWSKDQTYICMKS
MTAP mouse MASGSACTAVKIGIIGGTGLDDPEILEGRTEkYVDTPFGkPSDALILGKIKNVDCVLLARHGRQHTIMPSkVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIETAkKLGLRCHSKGTIVTIEGPRFSSRAESLIFRTWGADVVNMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSMEWSETLRNLKNMAQFSVLP--------------------------------------------PR--------------------H
MTAP rat MASGSACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRHHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIEMAKKLGLRCHSKGTIVTIEGPRFSSRAESFIFRTWGADVINMTTVPEVVLAKEAGLCYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSMEWSETLRNLKNMAQSSVLP--------------------------------------------PR--------------------H
  ****:::********************************************************:******************************************:**********::***:******::***********************:*************:**************::********:***************:************************:****:********************:******:***:*:::::::                                            **                    :
Consensus MASGSACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTSLRPQSFYDGSHCCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTIVTIEGPRFSSRAESFIFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSMEWSETLRNLKNMAQFSVLL--------------------------------------------PR--------------------H
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.