Multiple Sequence Alignment:
PC4 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       )
           |         |         |         |         |         |         |         |         |         |         |         |       
PC4 human MPKsKELVsssssGsDsDsEVDKKLKRKkQVAPEkPVkKQKTGETSRALsSskQssssRDDNMFQIGkMRYVSVRDFKGkVLIDIREYWMDPEGEMkPGRkGIsLNPEQWsQLkEQIsDIDDAVRkL
PC4 mouse MPKSKELVsssssGsDsDsEVEKKLKRKKQAVPEKPVKKQKPGETSRALASSkQsSSSRDDNMFQIGkMRYVSVRDFKGKILIDIREYWMDsEGEMKPGRKGISLNMEQWSQLKEQIsDIDDAVRKL
PC4 rat
  *********************:********::*********:*******:******************************:**********:**************:********************
Consensus MPKSKELVSSSSSGSDSDSEVDKKLKRKKQAAPEKPVKKQKPGETSRALASSKQSSSSRDDNMFQIGKMRYVSVRDFKGKILIDIREYWMDPEGEMKPGRKGISLNMEQWSQLKEQISDIDDAVRKL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.